Result : C0H415
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YnzI |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1885753 |
| Right | 1885917 |
| Strand | + |
| Nucleotide Sequence | GTGGATAGGAAAAAGGATGAAATACAAAGAAAATATAGGGAACAAATGAGGGAGAAGAAAGAACGAGAAAAAGAAGATGGCAGTTCACATACTTTTGAAATTGTTGTTGTGCTAGCCATTATCATTTTGATGTTTTTCTTTAATTCAGTTTTCAAGGCTTTTTAG |
| Sequence | MDRKKDEIQRKYREQMREKKEREKEDGSSHTFEIVVVLAIIILMFFFNSVFKAF |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H415 |
| ORF Length (Amino Acid) | 54 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1885753 | 1885917 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2061098 | 2061262 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 1787804 | 1787968 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2053603 | 2053767 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 4058348 | 4058512 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 179754 | 179900 | + | NZ_CP011937.1 | Bacillus velezensis |
| 7 | 3859575 | 3859721 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..