Result : A1S579

Protein Information

• Protein name: Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase)
• NCBI Accession ID: CP000507.1
• Organism: Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
• Left: 1617762
• Right: 1618037
• Strand: +
• Nucleotide Sequence: ATGAGGCGTGTGCTGATTCGGGTCAAGGGCAAGGTGCAGGGCGTGTGTTTCAGGCGGTTTGCCCTGGAGCGGGCGAGGGAGCTGGGGGTTACGGGGTATGTGACCAATATGGATGATGGCTCAGTGCAAATTCTGGCCCAGGGAAGTGCGCCCTTGGTGGAGAAACTCATTGATTGGTGCTGGGAGGGTTCACCCGCCGCCAGCGTCAATGCGGTGGAAGTCAATGAAGACGAGGCAGATGAAATCTACCTCGACTTTTCAATCACTCAGTCCTGA
• Sequence: MRRVLIRVKGKVQGVCFRRFALERARELGVTGYVTNMDDGSVQILAQGSAPLVEKLIDWCWEGSPAASVNAVEVNEDEADEIYLDFSITQS
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional
• Domain: CDD:412440
• Functional Category: Others
• Uniprot ID: A1S579
• ORF Length (Amino Acid): 91

Conservation Analysis

No. of Species: 22

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1493848	1494123	+	NZ_CP069213.1	Shewanella litorisediminis
2	1617762	1618037	+	NC_008700.1	Shewanella amazonensis SB2B
3	1050944	1051219	+	NZ_CP020373.1	Shewanella khirikhana
4	3427828	3428103	-	NC_009831.1	Shewanella sediminis HAW-EB3
5	1823010	1823285	-	NZ_CP014782.1	Shewanella psychrophila
6	1850287	1850559	+	NZ_CP046378.1	Shewanella algae
7	3134035	3134310	-	NC_014012.1	Shewanella violacea DSS12
8	2237459	2237734	+	NC_010506.1	Shewanella woodyi ATCC 51908
9	1805799	1806074	+	NC_011566.1	Shewanella piezotolerans WP3
10	2569872	2570141	-	NZ_CP022272.1	Shewanella marisflavi
11	2132800	2133072	+	NZ_CP022358.1	Shewanella bicestrii
12	2916041	2916316	-	NC_016901.1	Shewanella baltica OS678
13	1861653	1861922	+	NC_009092.1	Shewanella loihica PV-4
14	1875748	1876023	+	NC_009901.1	Shewanella pealeana ATCC 700345
15	1935259	1935528	+	NC_010334.1	Shewanella halifaxensis HAW-EB4
16	673815	674090	+	NZ_CP051180.1	Ferrimonas lipolytica
17	3235807	3236040	+	NZ_CP016278.1	Diaphorobacter polyhydroxybutyrativorans
18	962949	963206	+	NZ_CP011971.1	Steroidobacter denitrificans
19	2803450	2803710	-	NC_014541.1	Ferrimonas balearica DSM 9799
20	1635338	1635604	+	NC_017934.1	Mesotoga prima MesG1.Ag.4.2
21	1598135	1598398	+	NZ_CP012264.1	Cronobacter condimenti 1330
22	1642917	1643198	+	NZ_CP012266.1	Cronobacter dublinensis subsp. dublinensis LMG 23823

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP069213.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF03466.22	0.64	14	3912.0	same-strand	LysR substrate binding domain
2	PF00126.29	0.64	14	3912.0	same-strand	Bacterial regulatory helix-turn-helix protein, lysR family
3	PF03313.17	0.68	15	2426	opposite-strand	Serine dehydratase alpha chain
4	PF03315.17	0.68	15	2426	opposite-strand	Serine dehydratase beta chain
5	PF00933.23	0.68	15	1070	same-strand	Glycosyl hydrolase family 3 N terminal domain
6	PF05728.14	0.68	15	405	same-strand	Uncharacterised protein family (UPF0227)
7	PF10972.10	0.77	17	3	opposite-strand	Peptidoglycan-binding protein, CsiV
8	PF17757.3	0.77	17	1080	opposite-strand	UvrB interaction domain
9	PF03461.17	0.77	17	1080	opposite-strand	TRCF domain
10	PF02559.18	0.77	17	1080	opposite-strand	CarD-like/TRCF domain
11	PF00270.31	0.77	17	1080	opposite-strand	DEAD/DEAH box helicase
12	PF00271.33	0.77	17	1080	opposite-strand	Helicase conserved C-terminal domain
13	PF04851.17	0.77	17	1080	opposite-strand	Type III restriction enzyme, res subunit
14	PF12704.9	0.77	17	5374	same-strand	MacB-like periplasmic core domain
15	PF02687.23	0.77	17	5374	same-strand	FtsX-like permease family
16	PF00005.29	0.77	17	6678	same-strand	ABC transporter