| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000507.1 |
| Organism | Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) |
| Left | 1617762 |
| Right | 1618037 |
| Strand | + |
| Nucleotide Sequence | ATGAGGCGTGTGCTGATTCGGGTCAAGGGCAAGGTGCAGGGCGTGTGTTTCAGGCGGTTTGCCCTGGAGCGGGCGAGGGAGCTGGGGGTTACGGGGTATGTGACCAATATGGATGATGGCTCAGTGCAAATTCTGGCCCAGGGAAGTGCGCCCTTGGTGGAGAAACTCATTGATTGGTGCTGGGAGGGTTCACCCGCCGCCAGCGTCAATGCGGTGGAAGTCAATGAAGACGAGGCAGATGAAATCTACCTCGACTTTTCAATCACTCAGTCCTGA |
| Sequence | MRRVLIRVKGKVQGVCFRRFALERARELGVTGYVTNMDDGSVQILAQGSAPLVEKLIDWCWEGSPAASVNAVEVNEDEADEIYLDFSITQS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | A1S579 |
| ORF Length (Amino Acid) | 91 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1493848 | 1494123 | + | NZ_CP069213.1 | Shewanella litorisediminis |
| 2 | 1617762 | 1618037 | + | NC_008700.1 | Shewanella amazonensis SB2B |
| 3 | 1050944 | 1051219 | + | NZ_CP020373.1 | Shewanella khirikhana |
| 4 | 3427828 | 3428103 | - | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 5 | 1823010 | 1823285 | - | NZ_CP014782.1 | Shewanella psychrophila |
| 6 | 1850287 | 1850559 | + | NZ_CP046378.1 | Shewanella algae |
| 7 | 3134035 | 3134310 | - | NC_014012.1 | Shewanella violacea DSS12 |
| 8 | 2237459 | 2237734 | + | NC_010506.1 | Shewanella woodyi ATCC 51908 |
| 9 | 1805799 | 1806074 | + | NC_011566.1 | Shewanella piezotolerans WP3 |
| 10 | 2569872 | 2570141 | - | NZ_CP022272.1 | Shewanella marisflavi |
| 11 | 2132800 | 2133072 | + | NZ_CP022358.1 | Shewanella bicestrii |
| 12 | 2916041 | 2916316 | - | NC_016901.1 | Shewanella baltica OS678 |
| 13 | 1861653 | 1861922 | + | NC_009092.1 | Shewanella loihica PV-4 |
| 14 | 1875748 | 1876023 | + | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 15 | 1935259 | 1935528 | + | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 16 | 673815 | 674090 | + | NZ_CP051180.1 | Ferrimonas lipolytica |
| 17 | 3235807 | 3236040 | + | NZ_CP016278.1 | Diaphorobacter polyhydroxybutyrativorans |
| 18 | 962949 | 963206 | + | NZ_CP011971.1 | Steroidobacter denitrificans |
| 19 | 2803450 | 2803710 | - | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 20 | 1635338 | 1635604 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 21 | 1598135 | 1598398 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 22 | 1642917 | 1643198 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03466.22 | 0.64 | 14 | 3912.0 | same-strand | LysR substrate binding domain |
| 2 | PF00126.29 | 0.64 | 14 | 3912.0 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 3 | PF03313.17 | 0.68 | 15 | 2426 | opposite-strand | Serine dehydratase alpha chain |
| 4 | PF03315.17 | 0.68 | 15 | 2426 | opposite-strand | Serine dehydratase beta chain |
| 5 | PF00933.23 | 0.68 | 15 | 1070 | same-strand | Glycosyl hydrolase family 3 N terminal domain |
| 6 | PF05728.14 | 0.68 | 15 | 405 | same-strand | Uncharacterised protein family (UPF0227) |
| 7 | PF10972.10 | 0.77 | 17 | 3 | opposite-strand | Peptidoglycan-binding protein, CsiV |
| 8 | PF17757.3 | 0.77 | 17 | 1080 | opposite-strand | UvrB interaction domain |
| 9 | PF03461.17 | 0.77 | 17 | 1080 | opposite-strand | TRCF domain |
| 10 | PF02559.18 | 0.77 | 17 | 1080 | opposite-strand | CarD-like/TRCF domain |
| 11 | PF00270.31 | 0.77 | 17 | 1080 | opposite-strand | DEAD/DEAH box helicase |
| 12 | PF00271.33 | 0.77 | 17 | 1080 | opposite-strand | Helicase conserved C-terminal domain |
| 13 | PF04851.17 | 0.77 | 17 | 1080 | opposite-strand | Type III restriction enzyme, res subunit |
| 14 | PF12704.9 | 0.77 | 17 | 5374 | same-strand | MacB-like periplasmic core domain |
| 15 | PF02687.23 | 0.77 | 17 | 5374 | same-strand | FtsX-like permease family |
| 16 | PF00005.29 | 0.77 | 17 | 6678 | same-strand | ABC transporter |