| Protein name |
EXP04151 |
| NCBI Accession ID |
|
| Organism |
|
| Left |
|
| Right |
|
| Strand |
|
| Nucleotide Sequence |
GTGGAGAAAAACGATAAGCAGATCGGTTTTCGTGTTTCAGAAGAGCTGAAACGGCGGATCGAAGTACAGGCAGAAAAAGAAAAGCGCTCTGTCTCTAATTTGATCATCAAAGTGATGACCGAATATCTGGAACAACATGAAAATCAGGGCTGA |
| Sequence |
MEKNDKQIGFRVSEELKRRIEVQAEKEKRSVSNLIIKVMTEYLEQHENQG |
| Source of smORF |
Metagenomic Ribo-seq |
| Function |
The ORF matches to the profile of pfam07878. Profile Description: CopG-like RHH_1 or ribbon-helix-helix domain, RHH_5. This family contains bacterial proteins that form a ribbon-helix-helix fold. This fold occurs in many examples of bacterial antitoxins. |
| Pubmed ID |
32601270
|
| Domain |
CDD:400294 |
| Functional Category |
Conserved domain based functional assignment |
| Uniprot ID |
|
| ORF Length (Amino Acid) |
50 |