Protein name |
EXP04151 |
NCBI Accession ID |
|
Organism |
|
Left |
|
Right |
|
Strand |
|
Nucleotide Sequence |
GTGGAGAAAAACGATAAGCAGATCGGTTTTCGTGTTTCAGAAGAGCTGAAACGGCGGATCGAAGTACAGGCAGAAAAAGAAAAGCGCTCTGTCTCTAATTTGATCATCAAAGTGATGACCGAATATCTGGAACAACATGAAAATCAGGGCTGA |
Sequence |
MEKNDKQIGFRVSEELKRRIEVQAEKEKRSVSNLIIKVMTEYLEQHENQG |
Source of smORF |
Metagenomic Ribo-seq |
Function |
The ORF matches to the profile of pfam07878. Profile Description: CopG-like RHH_1 or ribbon-helix-helix domain, RHH_5. This family contains bacterial proteins that form a ribbon-helix-helix fold. This fold occurs in many examples of bacterial antitoxins. |
Pubmed ID |
32601270
|
Domain |
CDD:400294 |
Functional Category |
Conserved domain based functional assignment |
Uniprot ID |
|
ORF Length (Amino Acid) |
50 |