Protein Information |
Information Type | Description |
---|---|
Protein name | EXP04146 |
NCBI Accession ID | |
Organism | |
Left | |
Right | |
Strand | |
Nucleotide Sequence | GTGCTGATGCAGCTCAGCGACCGGATTCTGGTCATGTGCGGCGGCAAGGTCAGCGGCATTGTGGACCCCCGCAAGGTCACCAAGGACGAGATTGGACTGCTGATGATCCATGTGGAGCATCTGGATGAGGAGGTGCAGGCATGA |
Sequence | MLMQLSDRILVMCGGKVSGIVDPRKVTKDEIGLLMIHVEHLDEEVQA |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 47 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1260160 | 1260321 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
2 | 3075721 | 3075864 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
3 | 4838326 | 4838460 | - | NZ_CP022464.2 | Enterocloster bolteae |
4 | 3683563 | 3683721 | - | NZ_CP009687.1 | Clostridium aceticum |
5 | 1910181 | 1910321 | - | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
6 | 1647246 | 1647374 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
7 | 833854 | 833976 | + | NC_014761.1 | Oceanithermus profundus DSM 14977 |
8 | 1513428 | 1513556 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
9 | 1893999 | 1894154 | - | NC_019973.1 | Mesorhizobium australicum WSM2073 |
10 | 344373 | 344504 | - | NZ_CP036532.1 | Roseitalea porphyridii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02608.16 | 0.9 | 9 | 1526 | same-strand | ABC transporter substrate-binding protein PnrA-like |
2 | PF02653.18 | 0.9 | 9 | 962.5 | same-strand | Branched-chain amino acid transport system / permease component |