Result : C0H413

Protein Information

• Protein name: Uncharacterized protein YlzJ
• NCBI Accession ID: AL009126.3
• Organism: Bacillus subtilis (strain 168)
• Left: 1751935
• Right: 1752147
• Strand: +
• Nucleotide Sequence: ATGATTCTTTATACCGTGATGCCTCAGGAAATTGTGTTTGCAGAACAGAACCAAGAGACAAGCGCACATGAGCAAATTGAATATAAAGGTGTACCGCTTCTAGTCGAAATGAAAGGGAATGAAGCGGAAGTCATTCAAATCATGAGCACCAATCCAATGCATTTTCTGCATCCGGACATTTCACCGGGACAAAAGCTGAAATTAAACGTATAA
• Sequence: MILYTVMPQEIVFAEQNQETSAHEQIEYKGVPLLVEMKGNEAEVIQIMSTNPMHFLHPDISPGQKLKLNV
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of pfam14035. Profile Description: YlzJ-like protein. The YlzJ-like protein family includes the B. subtilis YlzJ protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 61 and 72 amino acids in length. There are two completely conserved residues (L and G) that may be functionally important.
• Pubmed ID: 9384377
• Domain: CDD:404849
• Functional Category: Others
• Uniprot ID: C0H413
• ORF Length (Amino Acid): 70

Conservation Analysis

No. of Species: 16

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1751935	1752147	+	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
2	1724795	1725007	+	NZ_CP013984.1	Bacillus inaquosorum
3	1719735	1719947	+	NZ_CP034943.1	Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499
4	1756081	1756293	+	NZ_CP051464.1	Bacillus mojavensis
5	1930469	1930681	+	NZ_CP033052.1	Bacillus vallismortis
6	233980	234192	-	NZ_CP029364.1	Bacillus halotolerans
7	1659566	1659781	+	NZ_CP048852.1	Bacillus tequilensis
8	1706515	1706724	+	NZ_CP053376.1	Bacillus amyloliquefaciens
9	2254398	2254607	-	NZ_CP011937.1	Bacillus velezensis
10	2030130	2030345	+	NZ_LT603683.1	Bacillus glycinifermentans
11	1864906	1865121	+	NC_006270.3	Bacillus licheniformis DSM 13 = ATCC 14580
12	1887554	1887769	+	NZ_CP023665.1	Bacillus paralicheniformis
13	39124	39360	-	NZ_CP017786.1	Bacillus xiamenensis
14	1660936	1661172	+	NZ_CP011150.1	Bacillus altitudinis
15	3647429	3647665	-	NZ_CP043404.1	Bacillus safensis
16	3313859	3314071	-	NC_013216.1	Desulfofarcimen acetoxidans DSM 771

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000964.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF02774.20	0.94	15	4899	same-strand	Semialdehyde dehydrogenase, dimerisation domain
2	PF01118.26	0.94	15	4899	same-strand	Semialdehyde dehydrogenase, NAD binding domain
3	PF00696.30	0.94	15	3596	same-strand	Amino acid kinase family
4	PF13840.8	0.94	15	3596	same-strand	ACT domain
5	PF00701.24	0.94	15	2695	same-strand	Dihydrodipicolinate synthetase family
6	PF17770.3	0.94	15	850	same-strand	Ribonuclease J C-terminal domain
7	PF00574.25	1.0	16	-3.0	same-strand	Clp protease
8	PF01580.20	0.94	15	130	same-strand	FtsK/SpoIIIE family
9	PF17854.3	1.0	16	130.0	same-strand	FtsK alpha domain
10	PF09397.12	1.0	16	130.0	same-strand	Ftsk gamma domain
11	PF07702.15	0.94	15	2634	same-strand	UTRA domain
12	PF00392.23	0.94	15	2634	same-strand	Bacterial regulatory proteins, gntR family
13	PF05193.23	0.81	13	6083	same-strand	Peptidase M16 inactive domain