Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YlzJ |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 1751935 |
Right | 1752147 |
Strand | + |
Nucleotide Sequence | ATGATTCTTTATACCGTGATGCCTCAGGAAATTGTGTTTGCAGAACAGAACCAAGAGACAAGCGCACATGAGCAAATTGAATATAAAGGTGTACCGCTTCTAGTCGAAATGAAAGGGAATGAAGCGGAAGTCATTCAAATCATGAGCACCAATCCAATGCATTTTCTGCATCCGGACATTTCACCGGGACAAAAGCTGAAATTAAACGTATAA |
Sequence | MILYTVMPQEIVFAEQNQETSAHEQIEYKGVPLLVEMKGNEAEVIQIMSTNPMHFLHPDISPGQKLKLNV |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam14035. Profile Description: YlzJ-like protein. The YlzJ-like protein family includes the B. subtilis YlzJ protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 61 and 72 amino acids in length. There are two completely conserved residues (L and G) that may be functionally important. |
Pubmed ID | 9384377 |
Domain | CDD:404849 |
Functional Category | Others |
Uniprot ID | C0H413 |
ORF Length (Amino Acid) | 70 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1751935 | 1752147 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1724795 | 1725007 | + | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 1719735 | 1719947 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
4 | 1756081 | 1756293 | + | NZ_CP051464.1 | Bacillus mojavensis |
5 | 1930469 | 1930681 | + | NZ_CP033052.1 | Bacillus vallismortis |
6 | 233980 | 234192 | - | NZ_CP029364.1 | Bacillus halotolerans |
7 | 1659566 | 1659781 | + | NZ_CP048852.1 | Bacillus tequilensis |
8 | 1706515 | 1706724 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
9 | 2254398 | 2254607 | - | NZ_CP011937.1 | Bacillus velezensis |
10 | 2030130 | 2030345 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
11 | 1864906 | 1865121 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
12 | 1887554 | 1887769 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
13 | 39124 | 39360 | - | NZ_CP017786.1 | Bacillus xiamenensis |
14 | 1660936 | 1661172 | + | NZ_CP011150.1 | Bacillus altitudinis |
15 | 3647429 | 3647665 | - | NZ_CP043404.1 | Bacillus safensis |
16 | 3313859 | 3314071 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02774.20 | 0.94 | 15 | 4899 | same-strand | Semialdehyde dehydrogenase, dimerisation domain |
2 | PF01118.26 | 0.94 | 15 | 4899 | same-strand | Semialdehyde dehydrogenase, NAD binding domain |
3 | PF00696.30 | 0.94 | 15 | 3596 | same-strand | Amino acid kinase family |
4 | PF13840.8 | 0.94 | 15 | 3596 | same-strand | ACT domain |
5 | PF00701.24 | 0.94 | 15 | 2695 | same-strand | Dihydrodipicolinate synthetase family |
6 | PF17770.3 | 0.94 | 15 | 850 | same-strand | Ribonuclease J C-terminal domain |
7 | PF00574.25 | 1.0 | 16 | -3.0 | same-strand | Clp protease |
8 | PF01580.20 | 0.94 | 15 | 130 | same-strand | FtsK/SpoIIIE family |
9 | PF17854.3 | 1.0 | 16 | 130.0 | same-strand | FtsK alpha domain |
10 | PF09397.12 | 1.0 | 16 | 130.0 | same-strand | Ftsk gamma domain |
11 | PF07702.15 | 0.94 | 15 | 2634 | same-strand | UTRA domain |
12 | PF00392.23 | 0.94 | 15 | 2634 | same-strand | Bacterial regulatory proteins, gntR family |
13 | PF05193.23 | 0.81 | 13 | 6083 | same-strand | Peptidase M16 inactive domain |