Result : EXP04142
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04142 |
| NCBI Accession ID | |
| Organism | Bacteroides |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGCGCGATACGTTATTCATTTGGGTCGAAGCTTATGAATATCCGTCCGGATTGCGGATAGAGGCATTCCTTTGGAGTGCTTCTATCATTTTGGGGAGGTTCATGAAGGAGCTGTTTTCATCTATTATTTTTTTAAAAGGTTAA |
| Sequence | MRDTLFIWVEAYEYPSGLRIEAFLWSASIILGRFMKELFSSIIFLKG |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 111754 | 111888 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 2 | 1414210 | 1414350 | - | NZ_CP015401.2 | Bacteroides caecimuris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012938.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08281.14 | 1.0 | 2 | 1100.0 | opposite-strand | Sigma-70, region 4 |
| 2 | PF04542.16 | 1.0 | 2 | 1100.0 | opposite-strand | Sigma-70 region 2 |
| 3 | PF04545.18 | 1.0 | 2 | 1100.0 | opposite-strand | Sigma-70, region 4 |
| 4 | PF07638.13 | 1.0 | 2 | 1100.0 | opposite-strand | ECF sigma factor |
| 5 | PF04773.15 | 1.0 | 2 | 24.0 | opposite-strand | FecR protein |
| 6 | PF16344.7 | 1.0 | 2 | 24.0 | opposite-strand | Domain of unknown function (DUF4974) |
| 7 | PF00593.26 | 1.0 | 2 | 47.0 | opposite-strand | TonB dependent receptor |
| 8 | PF07715.17 | 1.0 | 2 | 47.0 | opposite-strand | TonB-dependent Receptor Plug Domain |
| 9 | PF13715.8 | 1.0 | 2 | 47.0 | opposite-strand | CarboxypepD reg-like domain |
| 10 | PF13620.8 | 1.0 | 2 | 47.0 | opposite-strand | Carboxypeptidase regulatory-like domain |
| 11 | PF07660.16 | 1.0 | 2 | 47.0 | opposite-strand | Secretin and TonB N terminus short domain |
| 12 | PF14322.8 | 1.0 | 2 | 3514.0 | opposite-strand | Starch-binding associating with outer membrane |
| 13 | PF01011.23 | 1.0 | 2 | 4933.0 | opposite-strand | PQQ enzyme repeat |
| 14 | PF13360.8 | 1.0 | 2 | 4933.0 | opposite-strand | PQQ-like domain |
| 15 | PF13570.8 | 1.0 | 2 | 4933.0 | opposite-strand | PQQ-like domain |
| 16 | PF00041.23 | 1.0 | 2 | 4933.0 | opposite-strand | Fibronectin type III domain |
| 17 | PF01261.26 | 1.0 | 2 | 6904.0 | opposite-strand | Xylose isomerase-like TIM barrel |
++ More..