Result : EXP04134
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04134 |
| NCBI Accession ID | |
| Organism | Bacteroides |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGGAATGACGCTCGGTGCAACCGTAAAAATGCTTAGATTAGCACCGCTCGGCGATCCTGTCGAATTTCGTGTACTCAACTGTAACATAGGTATACGGAAAAAGGACGCCGAAAAAATTTTTATTCACAAGGTGGTGAAATGA |
| Sequence | MGMTLGATVKMLRLAPLGDPVEFRVLNCNIGIRKKDAEKIFIHKVVK |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 814125 | 814265 | - | NZ_CP058215.1 | Methanolobus zinderi |
| 2 | 1644094 | 1644237 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 3 | 1549494 | 1549649 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 4 | 1324238 | 1324369 | + | NZ_CP018787.1 | Oxalobacter formigenes |
| 5 | 16929 | 17072 | - | NZ_CP028102.1 | Fusobacterium mortiferum ATCC 9817 |
| 6 | 210179 | 210319 | + | NZ_CP065637.1 | Lactococcus garvieae |
| 7 | 177232 | 177372 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 8 | 985521 | 985655 | - | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 9 | 695628 | 695765 | + | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 10 | 1520542 | 1520673 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 11 | 1293471 | 1293608 | - | NZ_AP019367.1 | Parolsenella catena |
| 12 | 369501 | 369641 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 13 | 1788015 | 1788164 | + | NZ_CP019633.1 | Sedimentisphaera cyanobacteriorum |
| 14 | 782339 | 782488 | - | NZ_CP021023.1 | Sedimentisphaera salicampi |
| 15 | 327187 | 327318 | - | NZ_CP029256.1 | Christensenella minuta |
| 16 | 1110616 | 1110765 | + | NC_015436.1 | Sphaerochaeta coccoides DSM 17374 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP049887.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02421.20 | 1.0 | 16 | 37.0 | same-strand | Ferrous iron transport protein B |
| 2 | PF07670.16 | 1.0 | 16 | 56.5 | same-strand | Nucleoside recognition |
| 3 | PF07664.14 | 1.0 | 16 | 56.5 | same-strand | Ferrous iron transport protein B C terminus |
| 4 | PF01926.25 | 0.88 | 14 | 24 | same-strand | 50S ribosome-binding GTPase |
| 5 | PF17910.3 | 0.94 | 15 | 50 | same-strand | FeoB cytosolic helical domain |
| 6 | PF12669.9 | 0.62 | 10 | 2162.5 | same-strand | FeoB-associated Cys-rich membrane protein |
++ More..