Result : C0H412
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Swarming motility protein SwrD |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1701016 |
| Right | 1701231 |
| Strand | + |
| Nucleotide Sequence | ATGATTAAAGTAACCCGTTTGAACGGGCAGCCCTTTACACTGAATGCGCTATTTATTGAACAGATTGAATGTTTTCCGGATACTACAATTACTCTGTCAAATGGTAAGAAGTTTGTAGTAAAAGAAGATGAAGAAGCTGTTCTGGAAAAGATCGCAGCTTTCTACCGAAAAATACAAATATTTGCAATGGATCAAGGAATAGAGGAACCGGAATGA |
| Sequence | MIKVTRLNGQPFTLNALFIEQIECFPDTTITLSNGKKFVVKEDEEAVLEKIAAFYRKIQIFAMDQGIEEPE |
| Source of smORF | Swiss-Prot |
| Function | Required for swarming motility. Increases flagellar power, probably via the flagellar stator components MotA and MotB. {ECO:0000269|Pubmed:29061663}. |
| Pubmed ID | 9384377 19383706 29061663 |
| Domain | CDD:412517 |
| Functional Category | Others |
| Uniprot ID | C0H412 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 111
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1701016 | 1701231 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1608675 | 1608890 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 1668805 | 1669020 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1673881 | 1674096 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 1879358 | 1879573 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 1705154 | 1705369 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 284893 | 285108 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 1655788 | 1656003 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2305142 | 2305357 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 1806333 | 1806548 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 1828957 | 1829172 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 1828224 | 1828439 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 96901 | 97116 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 1602339 | 1602554 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 3716606 | 3716821 | - | NZ_CP043404.1 | Bacillus safensis |
| 16 | 2200671 | 2200892 | + | NZ_CP053989.1 | Niallia circulans |
| 17 | 1687375 | 1687587 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 18 | 645689 | 645910 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 19 | 3961237 | 3961446 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 20 | 1793918 | 1794139 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 21 | 1829869 | 1830093 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 22 | 1382513 | 1382734 | + | NZ_CP012024.1 | Bacillus smithii |
| 23 | 1066601 | 1066828 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 24 | 1245132 | 1245356 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 25 | 692972 | 693196 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 26 | 3431301 | 3431516 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 27 | 1499671 | 1499892 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 28 | 2762207 | 2762425 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 29 | 2125060 | 2125284 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 30 | 1303545 | 1303763 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 31 | 330985 | 331209 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 32 | 119518 | 119742 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 33 | 2340699 | 2340920 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 34 | 2737548 | 2737772 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 35 | 1458776 | 1458997 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 36 | 3877753 | 3877974 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 37 | 1697794 | 1698024 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 38 | 4935653 | 4935874 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 39 | 2064942 | 2065157 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 40 | 2096874 | 2097092 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 41 | 2538447 | 2538668 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 42 | 1574444 | 1574665 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 43 | 2693557 | 2693781 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 44 | 2311773 | 2311985 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 45 | 2540387 | 2540605 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 46 | 2641678 | 2641896 | - | NZ_LS483476.1 | Lederbergia lentus |
| 47 | 1210749 | 1210961 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 48 | 2039807 | 2040022 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 49 | 2511901 | 2512125 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 50 | 1536199 | 1536420 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 51 | 477271 | 477474 | + | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 52 | 2568878 | 2569090 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 53 | 1823137 | 1823352 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 54 | 1718236 | 1718457 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 55 | 244493 | 244696 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 56 | 241852 | 242055 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 57 | 3058767 | 3058991 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 58 | 109342 | 109530 | + | NZ_LN824141.1 | Defluviitoga tunisiensis |
| 59 | 3714665 | 3714886 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 60 | 1644358 | 1644579 | + | NC_011653.1 | Thermosipho africanus TCF52B |
| 61 | 2820986 | 2821183 | - | NC_002967.9 | Treponema denticola ATCC 35405 |
| 62 | 3623978 | 3624178 | - | NC_018020.1 | Turneriella parva DSM 21527 |
| 63 | 2728639 | 2728839 | + | NC_018020.1 | Turneriella parva DSM 21527 |
| 64 | 929245 | 929481 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 65 | 1246606 | 1246803 | + | NZ_CP009228.1 | Treponema putidum |
| 66 | 1821905 | 1822120 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 67 | 1409603 | 1409812 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 68 | 1087882 | 1088118 | + | NZ_CP033433.1 | Cohnella candidum |
| 69 | 1665251 | 1665454 | - | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 70 | 42260 | 42463 | + | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 71 | 656282 | 656479 | - | NC_022097.1 | Treponema pedis str. T A4 |
| 72 | 1893752 | 1893967 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 73 | 1928890 | 1929105 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 74 | 6131241 | 6131465 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 75 | 4730183 | 4730407 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 76 | 226421 | 226636 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 77 | 834464 | 834676 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 78 | 40725 | 40928 | + | NZ_CP014334.1 | Fervidobacterium islandicum |
| 79 | 2355040 | 2355234 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 80 | 1761280 | 1761504 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 81 | 2327760 | 2327945 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 82 | 4073397 | 4073600 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 83 | 3980548 | 3980763 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 84 | 428824 | 429033 | - | NZ_AP019551.1 | Athalassotoga saccharophila |
| 85 | 1306137 | 1306358 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 86 | 829770 | 829991 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 87 | 1675196 | 1675396 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 88 | 6344802 | 6345023 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 89 | 107152 | 107337 | + | NC_010003.1 | Petrotoga mobilis SJ95 |
| 90 | 1724360 | 1724584 | - | NZ_CP033614.1 | Leptospira kmetyi |
| 91 | 995975 | 996172 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 92 | 3589663 | 3589884 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 93 | 292682 | 292906 | - | NZ_CP028861.1 | Borreliella garinii |
| 94 | 2837496 | 2837723 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 95 | 3247695 | 3247916 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 96 | 2367431 | 2367646 | - | NZ_CP046996.1 | Dehalobacter restrictus |
| 97 | 2247613 | 2247813 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 98 | 1080655 | 1080876 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 99 | 2984710 | 2984901 | - | NZ_CP030775.1 | Clostridium butyricum |
| 100 | 865737 | 865961 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 101 | 3473859 | 3474083 | - | NZ_CP015217.1 | Leptospira tipperaryensis |
| 102 | 1285343 | 1285540 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 103 | 1394576 | 1394773 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 104 | 3294700 | 3294906 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 105 | 2941682 | 2941876 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 106 | 1119160 | 1119351 | + | NC_008593.1 | Clostridium novyi NT |
| 107 | 295107 | 295328 | - | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 108 | 5079824 | 5080021 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 109 | 295219 | 295440 | - | NC_008710.1 | Borrelia turicatae 91E135 |
| 110 | 612114 | 612335 | + | NZ_CP024333.1 | Borrelia miyamotoi |
| 111 | 1416945 | 1417157 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 112 | 2043081 | 2043293 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02120.18 | 0.86 | 96 | 1971.0 | same-strand | Flagellar hook-length control protein FliK |
| 2 | PF03963.16 | 0.84 | 93 | 1419 | same-strand | Flagellar hook capping protein - N-terminal region |
| 3 | PF06429.15 | 0.94 | 104 | 47 | same-strand | Flagellar basal body rod FlgEFG protein C-terminal |
| 4 | PF00460.22 | 0.93 | 103 | 47.0 | same-strand | Flagella basal body rod protein |
| 5 | PF03748.16 | 0.77 | 86 | -3.0 | same-strand | Flagellar basal body-associated protein FliL |
| 6 | PF02154.17 | 0.95 | 106 | 481 | same-strand | Flagellar motor switch protein FliM |
| 7 | PF01052.22 | 0.95 | 106 | 1440.0 | same-strand | Type III flagellar switch regulator (C-ring) FliN C-term |
| 8 | PF04509.14 | 0.85 | 94 | 1450.5 | same-strand | CheC-like family |
| 9 | PF00072.26 | 0.69 | 77 | 2650 | same-strand | Response regulator receiver domain |
++ More..