Result : EXP04127
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04127 |
| NCBI Accession ID | |
| Organism | |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGATCTCGGTTTCGTACGCGGCTCGCGCGTGTCGGTCGGCATGCGCAGTCCGCTAGGCAACCCCGTGGCCTATGTGGTGCGCGGCACGGCCATCGCGTTGCGCCGCGAACAAGCGCGCCAAATCATCGTCACTCCGTTATGA |
| Sequence | MDLGFVRGSRVSVGMRSPLGNPVAYVVRGTAIALRREQARQIIVTPL |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1450498 | 1450638 | + | NC_010729.1 | Porphyromonas gingivalis ATCC 33277 |
| 2 | 1971694 | 1971831 | - | NZ_LR134506.1 | Porphyromonas cangingivalis |
| 3 | 1646409 | 1646558 | + | NZ_LS483447.1 | Porphyromonas crevioricanis |
| 4 | 1045260 | 1045406 | + | NZ_CP041637.1 | Formosa sediminum |
| 5 | 1306236 | 1306379 | - | NZ_CP025938.1 | Tamlana carrageenivorans |
| 6 | 1002576 | 1002728 | + | NZ_CP022389.1 | Capnocytophaga canimorsus |
| 7 | 52891 | 53040 | - | NZ_CP012040.1 | Cyclobacterium amurskyense |
| 8 | 1523935 | 1524081 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 9 | 960479 | 960625 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 10 | 2416774 | 2416923 | + | NZ_CP022752.1 | Actinopolyspora erythraea |
| 11 | 1727596 | 1727733 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 12 | 1889349 | 1889495 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 13 | 2425524 | 2425670 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 14 | 742502 | 742654 | - | NC_011725.1 | Bacillus cereus B4264 |
| 15 | 1169069 | 1169218 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 16 | 1003336 | 1003503 | + | NZ_CP014176.1 | Clostridium argentinense |
| 17 | 657321 | 657470 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 18 | 1549494 | 1549649 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 19 | 2346205 | 2346348 | + | NC_018664.1 | Gottschalkia acidurici 9a |
| 20 | 2106074 | 2106223 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 21 | 2663952 | 2664068 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 22 | 923528 | 923677 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 23 | 908652 | 908780 | + | NZ_CP011663.1 | Clostridium sporogenes |
| 24 | 2983248 | 2983403 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 25 | 933812 | 933940 | + | NZ_CP028842.1 | Clostridium botulinum |
| 26 | 4286863 | 4287012 | + | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 27 | 775728 | 775865 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 28 | 2184048 | 2184200 | + | NZ_CP015079.1 | Nocardioides dokdonensis FR1436 |
| 29 | 978284 | 978427 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 30 | 4008264 | 4008413 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 31 | 559276 | 559431 | + | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 32 | 1905761 | 1905904 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 33 | 3397088 | 3397249 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 34 | 955212 | 955337 | - | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 35 | 925755 | 925913 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 36 | 266747 | 266869 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 37 | 1203188 | 1203334 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 38 | 2694032 | 2694172 | - | NZ_CP013910.1 | Deinococcus actinosclerus |
| 39 | 1999265 | 1999396 | - | NZ_LR134374.1 | Legionella spiritensis |
| 40 | 1102439 | 1102579 | - | NZ_AP023355.1 | Actinocatenispora thailandica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010729.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02421.20 | 0.97 | 39 | 3 | same-strand | Ferrous iron transport protein B |
| 2 | PF07670.16 | 0.97 | 39 | 696.0 | same-strand | Nucleoside recognition |
| 3 | PF01926.25 | 0.88 | 35 | 4.5 | same-strand | 50S ribosome-binding GTPase |
| 4 | PF07664.14 | 0.97 | 39 | 696.0 | same-strand | Ferrous iron transport protein B C terminus |
++ More..