Result : C0H411
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YlzH |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1575051 |
| Right | 1575236 |
| Strand | - |
| Nucleotide Sequence | ATGATTATAGCTTTTAAGATTGTTTTTGTCAATATTTTTTCTTTACAGCATAATGCTGCCATTGAAGTATCGTTGACAGCGGAATATGCTATGCATACACTTAAAACAAAAATAAGGCGTAAGAGTTTTCATTTGCAAATGTACCATACGTTTTTAAACATAGCAAGAAAGGCGGAAAAAATATGA |
| Sequence | MIIAFKIVFVNIFSLQHNAAIEVSLTAEYAMHTLKTKIRRKSFHLQMYHTFLNIARKAEKI |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H411 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1575051 | 1575236 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1547904 | 1548089 | - | NZ_CP013984.1 | Bacillus inaquosorum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01467.28 | 1.0 | 2 | 4488.0 | opposite-strand | Cytidylyltransferase-like |
| 2 | PF07670.16 | 1.0 | 2 | 3251.0 | same-strand | Nucleoside recognition |
| 3 | PF13180.8 | 1.0 | 2 | 1261.0 | opposite-strand | PDZ domain |
| 4 | PF17820.3 | 1.0 | 2 | 1261.0 | opposite-strand | PDZ domain |
| 5 | PF05636.13 | 1.0 | 2 | -3.0 | same-strand | HIGH Nucleotidyl Transferase |
| 6 | PF02620.19 | 1.0 | 2 | 28.0 | opposite-strand | Large ribosomal RNA subunit accumulation protein YceD |
| 7 | PF01783.25 | 1.0 | 2 | 568.0 | opposite-strand | Ribosomal L32p protein family |
| 8 | PF13248.8 | 1.0 | 2 | 568.0 | opposite-strand | zinc-ribbon domain |
| 9 | PF13921.8 | 1.0 | 2 | 893.5 | opposite-strand | Myb-like DNA-binding domain |
| 10 | PF00249.33 | 1.0 | 2 | 893.5 | opposite-strand | Myb-like DNA-binding domain |
| 11 | PF02558.18 | 1.0 | 2 | 2173.0 | opposite-strand | Ketopantoate reductase PanE/ApbA |
| 12 | PF08546.13 | 1.0 | 2 | 2173.0 | opposite-strand | Ketopantoate reductase PanE/ApbA C terminal |
++ More..