| Protein name |
EXP04116 |
| NCBI Accession ID |
|
| Organism |
Faecalibacterium |
| Left |
|
| Right |
|
| Strand |
|
| Nucleotide Sequence |
ATGACACTGGGGCAGAATATCCAGAATGCGCGCAGGGCGCAGGGGCTGAGCCAGGAGGCACTGGCTGAAAAGATCGGCGTTGCATACGTTCCCACTTCTAACGGCACTGTCTATCAGGCGGTCTGCCTGTTCGACGTGAACTGA |
| Sequence |
MTLGQNIQNARRAQGLSQEALAEKIGVAYVPTSNGTVYQAVCLFDVN |
| Source of smORF |
Metagenomic Ribo-seq |
| Function |
The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
| Pubmed ID |
32601270
|
| Domain |
CDD:419869 |
| Functional Category |
Conserved domain based functional assignment |
| Uniprot ID |
|
| ORF Length (Amino Acid) |
47 |