Result : C0H410
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YkzW |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1534120 |
| Right | 1534239 |
| Strand | + |
| Nucleotide Sequence | ATGGGTACGATTGTTTGCCAAGATTGCAACGAAGCCATTCATTACTTTGAAGATGAGAAAGTGACAACATTATATGGAACTTGCTGCGGACAATGTCAATGTCCTGTTGATGAAGAGTAA |
| Sequence | MGTIVCQDCNEAIHYFEDEKVTTLYGTCCGQCQCPVDEE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam13790. Profile Description: SR1 protein. This family of proteins is encoded by the dual function SR1 RNA. SR1 is a sRNA which regulates arginine metabolism, it also encodes a short protein that binds to glyceraldehyde-3-phosphate dehydrogenase (GapA) and stabilizes the gapA operon mRNAs. |
| Pubmed ID | 9384377 |
| Domain | CDD:372727 |
| Functional Category | Others |
| Uniprot ID | C0H410 |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 31
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1534120 | 1534239 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1505830 | 1505949 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1711036 | 1711155 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 451325 | 451444 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 1537678 | 1537797 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 1439412 | 1439531 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 7 | 1499222 | 1499341 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 8 | 1491777 | 1491896 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 2466705 | 2466824 | - | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 1639937 | 1640056 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 1662551 | 1662670 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 1654184 | 1654303 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 99939 | 100058 | - | NZ_CP043404.1 | Bacillus safensis |
| 14 | 1433886 | 1434005 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 263133 | 263252 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 16 | 2909315 | 2909440 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 17 | 2746552 | 2746680 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 18 | 2746740 | 2746868 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 19 | 484498 | 484620 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 20 | 911735 | 911848 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 21 | 1673918 | 1674043 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 22 | 3992248 | 3992376 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 23 | 3992422 | 3992550 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 24 | 3985360 | 3985488 | - | NC_011725.1 | Bacillus cereus B4264 |
| 25 | 3985533 | 3985661 | - | NC_011725.1 | Bacillus cereus B4264 |
| 26 | 3850978 | 3851106 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 27 | 3851152 | 3851280 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 28 | 3825554 | 3825682 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 29 | 3825728 | 3825856 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 30 | 1379220 | 1379348 | + | NZ_CP040336.1 | Bacillus luti |
| 31 | 1379046 | 1379174 | + | NZ_CP040336.1 | Bacillus luti |
| 32 | 2700493 | 2700615 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 33 | 3259855 | 3259974 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 34 | 1389972 | 1390094 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 35 | 1334893 | 1335018 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 36 | 1530075 | 1530197 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 37 | 10709 | 10819 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00198.25 | 0.71 | 22 | 2271.5 | same-strand | 2-oxoacid dehydrogenases acyltransferase (catalytic domain) |
| 2 | PF00364.24 | 0.71 | 22 | 2271.5 | same-strand | Biotin-requiring enzyme |
| 3 | PF02817.19 | 0.71 | 22 | 2271.5 | same-strand | e3 binding domain |
| 4 | PF07992.16 | 0.87 | 27 | 1341.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 5 | PF02852.24 | 0.87 | 27 | 1341.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
| 6 | PF00070.29 | 0.87 | 27 | 1341.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 7 | PF01276.22 | 1.0 | 31 | 118 | opposite-strand | Orn/Lys/Arg decarboxylase, major domain |
| 8 | PF05256.14 | 0.9 | 28 | 2759.0 | same-strand | Uncharacterised protein family (UPF0223) |
| 9 | PF06335.14 | 0.84 | 26 | 2689.5 | opposite-strand | Protein of unknown function (DUF1054) |
| 10 | PF00459.27 | 0.61 | 19 | 3310 | same-strand | Inositol monophosphatase family |
++ More..