Result : EXP04107
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04107 |
| NCBI Accession ID | |
| Organism | |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGCAGTTACGAAAATCAAAAGGCATATCTCAGGAAGAATTGGCAGAGAAACTTGATGTATCTCGTCAGGCCATATCTCGTTGGGAGACCGGAACTGCATTACCGGATGCAAATAATATTCTTGCCTTAAGCAAGTTATGGTAA |
| Sequence | MQLRKSKGISQEELAEKLDVSRQAISRWETGTALPDANNILALSKLW |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
| Pubmed ID | 32601270 |
| Domain | CDD:419869 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4249649 | 4249798 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 2 | 1779330 | 1779497 | + | NZ_CP014163.1 | Aerococcus urinaehominis |
| 3 | 3655134 | 3655256 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
++ More..