Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YkzT |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 1473240 |
Right | 1473401 |
Strand | - |
Nucleotide Sequence | ATGGGTACCTTAGTAATATTTAAAGAAAACGAAATGACTGTTTTAGAGGATATCAGTGAAGAAACTTACCTGAATATGAAGAAAGAATCAGCTGACCTTCAAGAAGAGCATCCTCCGTATCTGATTTGGCACGAAGACCTTCATTTTGATTATGGCTATTAA |
Sequence | MGTLVIFKENEMTVLEDISEETYLNMKKESADLQEEHPPYLIWHEDLHFDYGY |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | C0H406 |
ORF Length (Amino Acid) | 53 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1473240 | 1473401 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 512934 | 513095 | + | NZ_CP029364.1 | Bacillus halotolerans |
3 | 1448017 | 1448178 | - | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 1653504 | 1653665 | - | NZ_CP033052.1 | Bacillus vallismortis |
5 | 1440411 | 1440572 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
6 | 1381892 | 1382053 | - | NZ_CP048852.1 | Bacillus tequilensis |
7 | 1479514 | 1479675 | - | NZ_CP051464.1 | Bacillus mojavensis |
8 | 2575060 | 2575221 | + | NZ_CP011937.1 | Bacillus velezensis |
9 | 1383401 | 1383562 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
10 | 1592135 | 1592290 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03446.17 | 0.8 | 8 | 6651.5 | opposite-strand | NAD binding domain of 6-phosphogluconate dehydrogenase |
2 | PF14833.8 | 0.8 | 8 | 6651.5 | opposite-strand | NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase |
3 | PF03807.19 | 0.8 | 8 | 6651.5 | opposite-strand | NADP oxidoreductase coenzyme F420-dependent |
4 | PF00188.28 | 1.0 | 10 | 5833.5 | same-strand | Cysteine-rich secretory protein family |
5 | PF00905.24 | 1.0 | 10 | 3377.5 | opposite-strand | Penicillin binding protein transpeptidase domain |
6 | PF03717.17 | 0.8 | 8 | 3377.0 | opposite-strand | Penicillin-binding Protein dimerisation domain |
7 | PF00989.27 | 1.0 | 10 | 1393.0 | opposite-strand | PAS fold |
8 | PF13426.9 | 1.0 | 10 | 1393.0 | opposite-strand | PAS domain |
9 | PF02518.28 | 1.0 | 10 | 1393.0 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
10 | PF08447.14 | 1.0 | 10 | 1393.0 | opposite-strand | PAS fold |
11 | PF00512.27 | 1.0 | 10 | 1393.0 | opposite-strand | His Kinase A (phospho-acceptor) domain |
12 | PF00155.23 | 1.0 | 10 | 202.0 | same-strand | Aminotransferase class I and II |
13 | PF01584.21 | 1.0 | 10 | 207.0 | opposite-strand | CheW-like domain |
14 | PF00072.26 | 1.0 | 10 | 207.0 | opposite-strand | Response regulator receiver domain |
15 | PF14177.8 | 1.0 | 10 | 1161.0 | same-strand | YkyB-like protein |
16 | PF07690.18 | 1.0 | 10 | 1750.5 | same-strand | Major Facilitator Superfamily |
17 | PF03734.16 | 0.9 | 9 | 3119 | same-strand | L,D-transpeptidase catalytic domain |
18 | PF01476.22 | 0.8 | 8 | 3118.5 | same-strand | LysM domain |
19 | PF00149.30 | 0.9 | 9 | 3670 | same-strand | Calcineurin-like phosphoesterase |
20 | PF10518.11 | 0.7 | 7 | 3670 | same-strand | TAT (twin-arginine translocation) pathway signal sequence |