Result : EXP04089
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04089 |
| NCBI Accession ID | |
| Organism | Paeniclostridium,Romboutsia,Colletotrichum,Clostridium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAGAAATATTATATTAAAAACATTAAAAAAATCTAGTTATTTAGCCATGTTTGTTGCAGTGCTGTCTGCAAATACAACATGTACTTGGATAGTACATCAACCAAGTATGCCGAAAGATTTAAAAAAGTTAAAAAAGATATAA |
| Sequence | MRNIILKTLKKSSYLAMFVAVLSANTTCTWIVHQPSMPKDLKKLKKI |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl27940. Profile Description: Staphylococcal AgrD protein. Members of this family of short peptides are precursors to thiolactone (unless Cys is replaced by Ser) cyclic autoinducer peptides, used in quorum-sensing systems in Gram-positive bacteria. The best characterized is the AgrD precursor, processed by the AgrB protein. Nearby proteins regularly encountered include a histidine kinase and a response regulator. This model is related to pfam05931 but is newer and currently broader in scope. |
| Pubmed ID | 32601270 |
| Domain | CDD:391800 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 968865 | 969011 | + | NZ_CP019870.1 | Clostridioides difficile |
| 2 | 6403122 | 6403244 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 3 | 6277021 | 6277143 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 4 | 4880188 | 4880310 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP068595.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04647.17 | 1.0 | 4 | 18.0 | same-strand | Accessory gene regulator B |
| 2 | PF04055.23 | 1.0 | 4 | 328.5 | same-strand | Radical SAM superfamily |
| 3 | PF13186.8 | 1.0 | 4 | 328.5 | same-strand | Iron-sulfur cluster-binding domain |
| 4 | PF05402.14 | 1.0 | 4 | 41.0 | same-strand | Coenzyme PQQ synthesis protein D (PqqD) |
| 5 | PF00005.29 | 0.75 | 3 | 2559.0 | same-strand | ABC transporter |
| 6 | PF00664.25 | 0.75 | 3 | 3438 | same-strand | ABC transporter transmembrane region |
| 7 | PF04397.17 | 0.75 | 3 | 746 | opposite-strand | LytTr DNA-binding domain |
| 8 | PF00072.26 | 0.75 | 3 | 746 | opposite-strand | Response regulator receiver domain |
| 9 | PF14501.8 | 0.75 | 3 | 1538 | opposite-strand | GHKL domain |
| 10 | PF02518.28 | 0.75 | 3 | 1538 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
++ More..