Protein Information |
Information Type | Description |
---|---|
Protein name | EXP04085 |
NCBI Accession ID | |
Organism | Eubacterium |
Left | |
Right | |
Strand | |
Nucleotide Sequence | GTGGAAAAATTTAAAAAGACAGTGGCGAAAAATATTTCCGAACTTCGGCAACTTAATAAACTTACCCAGGCGAAGCTCGGCGAGAAAATCAATTATTCAGATAAGGCCGTATCAAAGTGGGAGACGGGGGTATCATTTAGATAA |
Sequence | MEKFKKTVAKNISELRQLNKLTQAKLGEKINYSDKAVSKWETGVSFR |
Source of smORF | Metagenomic Ribo-seq |
Function | |
Pubmed ID | 32601270 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 47 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1110936 | 1111073 | + | NZ_CP039126.1 | Blautia producta |
2 | 1326080 | 1326208 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
3 | 2360740 | 2360877 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13508.9 | 0.67 | 2 | 2328.0 | same-strand | Acetyltransferase (GNAT) domain |
2 | PF13443.8 | 0.67 | 2 | 828.5 | same-strand | Cro/C1-type HTH DNA-binding domain |