Result : C0H405
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YkzS |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1448013 |
| Right | 1448207 |
| Strand | + |
| Nucleotide Sequence | TTGCGTCCCGAAGAAATAACAGAAATGATTGAACAGCTGCGCACCGGCGCCATAAACGAACTGAGAGTCCAGAAAGAGCATTTTCTTGATTTCAGGGCCGTGTTATCTAAACAAGATGATTTTAAACATTTCCGAGGAATTGCCCAGCAAGGCGGAGATGTTATCTTTCAATACTTAGAACAGCCAAGAAGCTGA |
| Sequence | MRPEEITEMIEQLRTGAINELRVQKEHFLDFRAVLSKQDDFKHFRGIAQQGGDVIFQYLEQPRS |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H405 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 39
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1415144 | 1415338 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 2 | 1448013 | 1448207 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 1356861 | 1357055 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 1628319 | 1628513 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 1454240 | 1454434 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 538183 | 538377 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1420767 | 1420961 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 8 | 2599227 | 2599385 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1359238 | 1359396 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 1560157 | 1560315 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 1551758 | 1551952 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 1575159 | 1575353 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 2965867 | 2966025 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 14 | 1617532 | 1617690 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 15 | 844112 | 844270 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 16 | 2686526 | 2686720 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 1870638 | 1870832 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 18 | 408140 | 408334 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 19 | 1346962 | 1347156 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 20 | 197247 | 197441 | - | NZ_CP043404.1 | Bacillus safensis |
| 21 | 2341428 | 2341586 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 22 | 1232368 | 1232550 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 23 | 351418 | 351612 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 24 | 1556987 | 1557166 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 25 | 1531380 | 1531574 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 26 | 1004898 | 1005056 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 27 | 477815 | 477973 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 28 | 2742265 | 2742435 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 29 | 2958478 | 2958636 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 30 | 129681 | 129839 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 31 | 5141718 | 5141912 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 32 | 2823207 | 2823401 | - | NZ_LS483476.1 | Lederbergia lentus |
| 33 | 1996601 | 1996795 | + | NZ_CP053989.1 | Niallia circulans |
| 34 | 819838 | 819996 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 35 | 3850141 | 3850299 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 36 | 1197705 | 1197872 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 37 | 3350976 | 3351170 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 38 | 1177536 | 1177730 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 39 | 2206024 | 2206218 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 40 | 252928 | 253122 | + | NC_013792.1 | Alkalihalobacillus pseudofirmus OF4 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09953.11 | 0.95 | 37 | 200 | opposite-strand | Uncharacterized protein conserved in bacteria (DUF2187) |
| 2 | PF07486.14 | 0.62 | 24 | 271.5 | same-strand | Cell Wall Hydrolase |
++ More..