Result : EXP04078
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04078 |
| NCBI Accession ID | |
| Organism | Streptococcus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAAAGATTTACTTAAAACTGTAGAAACTTTTTTAACCTATTCAGAAGCCAAGTTAGAGGAACTATCAGAAAAAAATCAGCAACTTAAAACGGAATTACCGAGGAAAGAGGAGGTGAAGAAGCAAGCATGAAAAAGCTCTTAA |
| Sequence | MKDLLKTVETFLTYSEAKLEELSEKNQQLKTELPRKEEVKKQAWKSS |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 9283 | 9414 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 2 | 1988215 | 1988337 | + | NZ_LT906439.1 | Streptococcus merionis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017581.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06071.15 | 1.0 | 2 | 5194.0 | same-strand | Protein of unknown function (DUF933) |
| 2 | PF01195.21 | 1.0 | 2 | 4323.0 | same-strand | Peptidyl-tRNA hydrolase |
| 3 | PF02559.18 | 1.0 | 2 | 819.5 | same-strand | CarD-like/TRCF domain |
| 4 | PF17757.3 | 1.0 | 2 | 819.5 | same-strand | UvrB interaction domain |
| 5 | PF03461.17 | 1.0 | 2 | 819.5 | same-strand | TRCF domain |
| 6 | PF00270.31 | 1.0 | 2 | 819.5 | same-strand | DEAD/DEAH box helicase |
| 7 | PF00271.33 | 1.0 | 2 | 819.5 | same-strand | Helicase conserved C-terminal domain |
| 8 | PF04851.17 | 1.0 | 2 | 819.5 | same-strand | Type III restriction enzyme, res subunit |
| 9 | PF01479.27 | 1.0 | 2 | 362.5 | same-strand | S4 domain |
| 10 | PF04977.17 | 1.0 | 2 | 0.0 | same-strand | Septum formation initiator |
| 11 | PF13354.8 | 1.0 | 2 | 7.5 | same-strand | Beta-lactamase enzyme family |
| 12 | PF19087.2 | 1.0 | 2 | 7.5 | same-strand | Domain of unknown function (DUF5776) |
| 13 | PF01171.22 | 1.0 | 2 | 1293.5 | same-strand | PP-loop family |
| 14 | PF00156.29 | 1.0 | 2 | 2601.0 | same-strand | Phosphoribosyl transferase domain |
| 15 | PF01434.20 | 1.0 | 2 | 3172.5 | same-strand | Peptidase family M41 |
| 16 | PF00004.31 | 1.0 | 2 | 3172.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 17 | PF17862.3 | 1.0 | 2 | 3172.5 | same-strand | AAA+ lid domain |
| 18 | PF06480.17 | 1.0 | 2 | 3172.5 | same-strand | FtsH Extracellular |
++ More..