Result : C0H404
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probably inactive glycosylase YkzR |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1446317 |
| Right | 1446568 |
| Strand | + |
| Nucleotide Sequence | TTGTTAGTAAAAAGGCATAGCGGGACAATTATTTTTGACACCAAGAGTCAATCTCCAAAAGCTATTTTTACTGTCAATCACGATAAAAAGGGGCCGTTGCCTTCGGGAACATATACATTATGGTTTGAAAATGAACAGTCACTCAGAGCAAAAATAAAACTCGCTCAAAAATATAATCTGAAAGGTCTTGGCAGCTGGAGTCTTGGACAAGAAGATGCGTCAGTCTGGAATACAGTGTTTAAAAATATATAA |
| Sequence | MLVKRHSGTIIFDTKSQSPKAIFTVNHDKKGPLPSGTYTLWFENEQSLRAKIKLAQKYNLKGLGSWSLGQEDASVWNTVFKNI |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 19383706 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H404 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1446317 | 1446568 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1419419 | 1419718 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 539422 | 539721 | - | NZ_CP029364.1 | Bacillus halotolerans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13524.8 | 1.0 | 3 | 977 | same-strand | Glycosyl transferases group 1 |
| 2 | PF01476.22 | 1.0 | 3 | 862.5 | same-strand | LysM domain |
| 3 | PF11514.10 | 1.0 | 3 | 285 | same-strand | Protein of unknown function (DUF3219) |
| 4 | PF09953.11 | 1.0 | 3 | 699 | opposite-strand | Uncharacterized protein conserved in bacteria (DUF2187) |
| 5 | PF07486.14 | 1.0 | 3 | 1542 | same-strand | Cell Wall Hydrolase |
| 6 | PF01943.19 | 1.0 | 3 | 2289 | same-strand | Polysaccharide biosynthesis protein |
| 7 | PF01554.20 | 1.0 | 3 | 2289 | same-strand | MatE |
| 8 | PF01242.21 | 0.67 | 2 | 3803.5 | same-strand | 6-pyruvoyl tetrahydropterin synthase |
| 9 | PF14489.8 | 0.67 | 2 | 2564.5 | same-strand | QueF-like protein |
++ More..