Result : EXP04063
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04063 |
| NCBI Accession ID | |
| Organism | Lachnoanaerobaculum,Eubacterium,Coprococcus,Clostridium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | TTGGGGGACACACCCGTTCTCATCCCGAACACGATGGTTAAGACCCAAGCGGCCGATGGTACTATACTGGAGACGGTATGGGAGAGCAGGTGGCTGCCAGATTTAAATGGGCTTATAGCTCAGCCGGTTAGAGCGCACGCCTGA |
| Sequence | MGDTPVLIPNTMVKTQAADGTILETVWESRWLPDLNGLIAQPVRAHA |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 14352 | 14504 | + | NZ_HG917868.1 | Clostridium bornimense |
| 2 | 2750769 | 2750918 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 3 | 2282458 | 2282607 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 4 | 2533421 | 2533564 | - | NC_008593.1 | Clostridium novyi NT |
| 5 | 237500 | 237643 | + | NZ_CP040924.1 | Clostridium thermarum |
| 6 | 14457 | 14600 | + | NZ_CP040924.1 | Clostridium thermarum |
| 7 | 14392 | 14535 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 8 | 113339 | 113485 | + | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 9 | 4599499 | 4599645 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 10 | 2313034 | 2313159 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 11 | 13683 | 13799 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 12 | 4553571 | 4553711 | - | NC_014393.1 | Clostridium cellulovorans 743B |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_HG917868.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02463.21 | 0.62 | 5 | 9857 | same-strand | RecF/RecN/SMC N terminal domain |
| 2 | PF04025.14 | 0.62 | 5 | 9571 | same-strand | Domain of unknown function (DUF370) |
| 3 | PF00204.27 | 0.62 | 5 | 7635 | same-strand | DNA gyrase B |
| 4 | PF00986.23 | 0.62 | 5 | 7635 | same-strand | DNA gyrase B subunit, carboxyl terminus |
| 5 | PF02518.28 | 0.62 | 5 | 7631 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 6 | PF01751.24 | 0.62 | 5 | 7635 | same-strand | Toprim domain |
| 7 | PF00521.22 | 0.62 | 5 | 5178 | same-strand | DNA gyrase/topoisomerase IV, subunit A |
| 8 | PF03989.15 | 0.62 | 5 | 5178 | same-strand | DNA gyrase C-terminal domain, beta-propeller |
| 9 | PF02829.16 | 0.62 | 5 | 750 | same-strand | 3H domain |
| 10 | PF08279.14 | 0.62 | 5 | 750 | same-strand | HTH domain |
++ More..