Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YkzQ |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 1445314 |
Right | 1445541 |
Strand | + |
Nucleotide Sequence | ATGAAGGGGAAAATACCTAAAATAAGAAATCAAGCGAATAAAGTAAAAAGAACGCCTCGTTATATGGAATTTCCCGTGACATACGAAGTATATCATGTGGAATCCGGCGATACATTATGGACGATTGCCAAATCCTTTGAAATTCCGGTACAACAACTTATGAATCTTAATAAGCTTTCTTCAGATAGAATTTATCCTGGACAAATTATAAAGATAAGAGAAAGATAA |
Sequence | MKGKIPKIRNQANKVKRTPRYMEFPVTYEVYHVESGDTLWTIAKSFEIPVQQLMNLNKLSSDRIYPGQIIKIRER |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl21525. Profile Description: Lysin Motif is a small domain involved in binding peptidoglycan. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known. |
Pubmed ID | 9384377 19383706 |
Domain | CDD:419709 |
Functional Category | Others |
Uniprot ID | C0H403 |
ORF Length (Amino Acid) | 75 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1445314 | 1445541 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1418458 | 1418685 | + | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 540443 | 540628 | - | NZ_CP029364.1 | Bacillus halotolerans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF14489.8 | 1.0 | 3 | 1729 | same-strand | QueF-like protein |
2 | PF13524.8 | 1.0 | 3 | 16 | same-strand | Glycosyl transferases group 1 |
3 | PF01476.22 | 1.0 | 3 | 16 | same-strand | LysM domain |
4 | PF11514.10 | 1.0 | 3 | 1318 | same-strand | Protein of unknown function (DUF3219) |
5 | PF09953.11 | 1.0 | 3 | 1732 | opposite-strand | Uncharacterized protein conserved in bacteria (DUF2187) |
6 | PF07486.14 | 1.0 | 3 | 2575 | same-strand | Cell Wall Hydrolase |
7 | PF06508.15 | 0.67 | 2 | 3311.5 | same-strand | Queuosine biosynthesis protein QueC |
8 | PF01242.21 | 0.67 | 2 | 2869.5 | same-strand | 6-pyruvoyl tetrahydropterin synthase |