Result : EXP04059
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04059 |
| NCBI Accession ID | |
| Organism | |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAAGAATGTTAACAAAGGAGTACTTAAGGTTATTGAAAGGTTGATGAGGAATGAAGCTACACAGAGTGCAGGTAAATTTCCGCCTATATGTTTAGGTATATTGCATCAGCCAATGCGTCCTGTAAGCCCTAAGAAAATATAA |
| Sequence | MKNVNKGVLKVIERLMRNEATQSAGKFPPICLGILHQPMRPVSPKKI |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2720625 | 2720765 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 2 | 3462089 | 3462217 | - | NZ_LR699011.1 | Roseburia hominis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR027880.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04647.17 | 1.0 | 2 | 257.0 | same-strand | Accessory gene regulator B |
++ More..