| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YkzP |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1417561 |
| Right | 1417716 |
| Strand | + |
| Nucleotide Sequence | ATGAAGCGTAAAGCTGAAGTGAATGAAGCCATTAAAAATAACAATACACCTACCGAGAGCATGGACCCCAATTCATATAAGACACAATATCATGACGACCCCAATTTTAGAGGGGCAAACCGCAATTCCAAACAGGGCCAGCAGGGAGGCATGTAA |
| Sequence | MKRKAEVNEAIKNNNTPTESMDPNSYKTQYHDDPNFRGANRNSKQGQQGGM |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H402 |
| ORF Length (Amino Acid) | 51 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1417561 | 1417716 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1392686 | 1392841 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1329646 | 1329801 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 1389230 | 1389385 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 1599996 | 1600151 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 566488 | 566643 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1428016 | 1428171 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2627003 | 2627158 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1333572 | 1333727 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 1541559 | 1541720 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 375310 | 375474 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 12 | 1462303 | 1462455 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 13 | 1480503 | 1480664 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 1322319 | 1322483 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 15 | 223364 | 223528 | - | NZ_CP043404.1 | Bacillus safensis |
| 16 | 2719719 | 2719871 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 1192833 | 1192988 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 18 | 795193 | 795348 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 19 | 3009348 | 3009509 | - | NZ_CP070511.1 | Parageobacillus toebii |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00269.22 | 0.79 | 15 | 4002 | opposite-strand | Small, acid-soluble spore proteins, alpha/beta type |
| 2 | PF08876.13 | 0.79 | 15 | 3166 | opposite-strand | Domain of unknown function (DUF1836) |
| 3 | PF01435.20 | 0.84 | 16 | 2113.5 | same-strand | Peptidase family M48 |
| 4 | PF02386.18 | 0.84 | 16 | 614.5 | same-strand | Cation transport protein |
| 5 | PF01757.24 | 0.84 | 16 | 215.5 | opposite-strand | Acyltransferase family |
| 6 | PF02518.28 | 0.95 | 18 | 1502.0 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 7 | PF08448.12 | 0.95 | 18 | 1502.0 | same-strand | PAS fold |
| 8 | PF13426.9 | 0.74 | 14 | 1507.5 | same-strand | PAS domain |
| 9 | PF00512.27 | 0.95 | 18 | 1502.0 | same-strand | His Kinase A (phospho-acceptor) domain |
| 10 | PF01035.22 | 0.89 | 17 | 3710 | same-strand | 6-O-methylguanine DNA methyltransferase, DNA binding domain |
| 11 | PF02870.17 | 0.89 | 17 | 3710 | same-strand | 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain |
| 12 | PF00989.27 | 0.63 | 12 | 1515.5 | same-strand | PAS fold |