ProsmORF-pred
Result : A1R4R0
Protein Information
Information Type Description
Protein name Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-)
NCBI Accession ID CP000474.1
Organism Paenarthrobacter aurescens (strain TC1)
Left 1586100
Right 1586396
Strand +
Nucleotide Sequence ATGGCTGCGATCAACCGTGACGACGTCGCGCATCTTGCGCGTCTGGCTCACATTGAAATGAGTGCCGAAGAACTGGACAGGATGGCTGTTGAGCTTGCTGTCATCGTGGATTCGGTGAAGAGCGTGAGCGAAGCTGCGGGTGAGGACGTCCCGGCGACGTCGCACCCGATTCCGTTGACCAATGTGTTCCGTGAGGACGTTGTGGGCCACACGTTCACAGCTGAGCAGGCGTTGTCCGGCGCTCCGGATTCTTACGAGAACCGTTTCAAGGTCCCGGCAATCCTGGATGAGGACTAA
Sequence MAAINRDDVAHLARLAHIEMSAEELDRMAVELAVIVDSVKSVSEAAGEDVPATSHPIPLTNVFREDVVGHTFTAEQALSGAPDSYENRFKVPAILDED
Source of smORF Swiss-Prot
Function Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}.
Pubmed ID 17194220
Domain CDD:412411
Functional Category Others
Uniprot ID A1R4R0
ORF Length (Amino Acid) 98
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 270
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1589670 1589966 + NZ_CP068013.1 Paenarthrobacter ureafaciens
2 732300 732596 + NZ_CP013745.1 Arthrobacter alpinus
3 1710496 1710792 + NZ_CP029642.1 Arthrobacter dokdonellae
4 3476570 3476866 + NZ_CP018863.1 Arthrobacter crystallopoietes
5 1096055 1096351 + NC_010168.1 Renibacterium salmoninarum ATCC 33209
6 1759928 1760224 - NZ_CP011005.1 Psychromicrobium lacuslunae
7 943465 943761 + NZ_LR131272.1 Arthrobacter agilis
8 1063345 1063641 - NZ_CP018135.1 Neomicrococcus aestuarii
9 1821553 1821849 + NZ_CP013254.1 Kocuria flava
10 2020715 2021011 - NZ_CP012507.1 Kocuria palustris
11 1871592 1871888 - NZ_CP056080.1 Rothia nasimurium
12 900933 901229 + NZ_CP035504.1 Kocuria indica
13 771301 771597 + NZ_CP034412.1 Glutamicibacter creatinolyticus
14 1884170 1884466 - NZ_CP061539.1 Rothia terrae
15 1769568 1769864 - NZ_CP061538.1 Rothia amarae
16 670894 671190 + NZ_LR134479.1 Rothia aeria
17 964318 964614 + NZ_CP033081.1 Glutamicibacter nicotianae
18 992147 992443 + NC_014550.1 Glutamicibacter arilaitensis Re117
19 3432566 3432862 + NZ_CP042260.1 Glutamicibacter halophytocola
20 7734509 7734808 - NC_017093.1 Actinoplanes missouriensis 431
21 2282237 2282533 - NZ_CP016282.1 Cryobacterium arcticum
22 8072611 8072910 - NC_022657.1 Actinoplanes friuliensis DSM 7358
23 7246617 7246916 - NZ_CP023865.1 Actinoplanes teichomyceticus ATCC 31121
24 406659 406955 - NZ_CP022316.1 Brachybacterium avium
25 4380408 4380704 + NZ_CP030033.1 Cryobacterium soli
26 1649863 1650159 + NC_014643.1 Rothia dentocariosa ATCC 17931
27 313143 313442 - NZ_CP038436.1 Nocardioides seonyuensis
28 2111053 2111349 + NZ_CP023563.1 Brachybacterium vulturis
29 3716310 3716609 - NZ_CP022295.1 Nocardioides aromaticivorans
30 5675037 5675333 + NC_016109.1 Kitasatospora setae KM-6054
31 4970446 4970745 + NZ_CP041146.1 Nocardioides humi
32 1626361 1626657 + NZ_CP023564.1 Brachybacterium ginsengisoli
33 1375414 1375719 + NC_009380.1 Salinispora tropica CNB-440
34 2643732 2644028 - NZ_CP023698.1 Streptomyces viridifaciens
35 107772 108077 + NZ_CP045309.1 Micromonospora terminaliae
36 1213646 1213951 - NZ_CP061725.1 Micromonospora craniellae
37 1297373 1297678 + NC_014391.1 Micromonospora aurantiaca ATCC 27029
38 4751224 4751520 + NZ_CP031264.1 Streptacidiphilus bronchialis
39 1872638 1872937 + NZ_CP016174.1 Amycolatopsis orientalis
40 5288376 5288672 + NZ_CP029043.1 Streptomyces nigra
41 3053701 3054000 - NZ_CP017146.1 Marisediminicola antarctica
42 3933835 3934134 - NZ_CP009896.1 Pimelobacter simplex
43 5956144 5956440 + NZ_CP019457.1 Streptomyces lydicus
44 1593343 1593639 - NC_020990.1 Streptomyces albidoflavus
45 1968502 1968798 - NZ_CP031742.1 Streptomyces koyangensis
46 2118820 2119116 - NC_013172.1 Brachybacterium faecium DSM 4810
47 2404525 2404821 - NZ_CP023701.1 Streptomyces subrutilus
48 3171862 3172158 - NZ_CP023699.1 Streptomyces kanamyceticus
49 1515649 1515945 - NZ_CP031356.1 Brachybacterium saurashtrense
50 3126285 3126581 - NZ_CP045643.1 Streptomyces fagopyri
51 6538776 6539072 + NZ_CP022685.1 Streptomyces formicae
52 7039732 7040031 - NC_021252.1 Amycolatopsis keratiniphila
53 5609552 5609848 + NZ_CP023695.1 Streptomyces alboniger
54 1363018 1363317 - NZ_CP028129.1 Rathayibacter rathayi
55 1635361 1635660 + NZ_CP008953.1 Amycolatopsis japonica
56 3372343 3372639 - NC_003155.5 Streptomyces avermitilis MA-4680 = NBRC 14893
57 10177578 10177820 - NZ_CP012752.1 Kibdelosporangium phytohabitans
58 994345 994620 + NZ_CP049257.1 Nocardioides anomalus
59 5430024 5430320 + NZ_CP029196.1 Streptomyces venezuelae
60 5894495 5894791 + NZ_CP010407.1 Streptomyces vietnamensis
61 1845528 1845827 - NZ_CP026949.1 Mycetocola zhujimingii
62 204278 204601 + NZ_CP044344.1 Nocardioides cynanchi
63 2804508 2804804 - NZ_CP034687.1 Streptomyces griseoviridis
64 6299736 6300032 + NZ_CP015098.1 Streptomyces qaidamensis
65 2806839 2807135 - NZ_CP011340.1 Streptomyces pristinaespiralis
66 6141977 6142273 + NZ_CP023691.1 Streptomyces platensis
67 2618161 2618457 - NZ_CP026652.1 Streptomyces dengpaensis
68 5641734 5642030 + NZ_CP072931.1 Streptomyces auratus AGR0001
69 6375047 6375343 + NZ_CP027306.1 Streptomyces atratus
70 5574286 5574582 + NZ_CP024957.1 Streptomyces cavourensis
71 5969502 5969798 + NZ_CP020563.1 Kitasatospora albolonga
72 6175250 6175546 + NZ_CP059991.1 Streptomyces gardneri
73 5351258 5351554 + NZ_AP023439.1 Streptomyces tuirus
74 2049494 2049790 - NZ_CP023202.1 Streptomyces xinghaiensis S187
75 2302082 2302378 - NZ_CP023692.1 Streptomyces vinaceus
76 1838859 1839155 + NZ_CP016279.1 Streptomyces griseochromogenes
77 5571494 5571790 + NZ_CP012382.1 Streptomyces ambofaciens ATCC 23877
78 1484156 1484455 + NZ_CP011502.1 Aeromicrobium erythreum
79 1666134 1666433 - NZ_CP015515.1 Rathayibacter tritici
80 6255960 6256256 + NZ_CP071139.1 Streptomyces nojiriensis
81 8042580 8042876 - NZ_CP063373.1 Streptomyces ferrugineus
82 6104947 6105243 + NZ_CP021978.1 Streptomyces hawaiiensis
83 5753024 5753320 + NZ_CP031194.1 Streptomyces paludis
84 916967 917266 - NC_009664.2 Kineococcus radiotolerans SRS30216 = ATCC BAA-149
85 5289512 5289808 + NZ_CP021080.1 Streptomyces pluripotens
86 5933833 5934129 + NC_021985.1 Streptomyces collinus Tu 365
87 3354254 3354550 - NZ_CP017248.1 Streptomyces fodineus
88 5345619 5345915 + NZ_CP023693.1 Streptomyces cinereoruber
89 3058660 3058956 - NZ_CP022744.1 Streptomyces lincolnensis
90 1736539 1736844 + NZ_CP058322.1 Micromonospora carbonacea
91 6273809 6274105 + NZ_CP020569.1 Streptomyces gilvosporeus
92 1324101 1324397 + NZ_CP030862.1 Streptomyces globosus
93 6645552 6645848 + NZ_CP023690.1 Streptomyces spectabilis
94 1569853 1570128 + NZ_CP033724.1 Clavibacter michiganensis subsp. michiganensis
95 2417663 2417962 - NZ_CP047180.1 Rathayibacter festucae
96 5760071 5760367 + NZ_CP063374.1 Streptomyces chromofuscus
97 1753118 1753414 - NZ_CP065253.1 Streptomyces clavuligerus
98 1963074 1963370 - NZ_CP048882.1 Streptomyces bathyalis
99 6164172 6164468 + NZ_CP023407.1 Streptomyces fungicidicus
100 2082333 2082629 - NZ_CP034279.1 Streptomyces ficellus
101 8407161 8407460 - NZ_CP007155.1 Kutzneria albida DSM 43870
102 2364181 2364477 - NZ_CP022310.1 Streptomyces calvus
103 2389479 2389775 - NC_010572.1 Streptomyces griseus subsp. griseus NBRC 13350
104 2460049 2460357 - NZ_CP045737.1 Aeromicrobium yanjiei
105 6527607 6527903 + NZ_CP023694.1 Streptomyces coeruleorubidus
106 6687226 6687522 + NZ_CP070326.1 Streptomyces noursei
107 3362951 3363250 + NZ_CP060713.1 Nocardioides mesophilus
108 775069 775365 - NZ_LN849456.1 Devriesea agamarum
109 2978329 2978625 - NZ_CP032427.1 Streptomyces griseorubiginosus
110 5923988 5924284 + NZ_CP020570.1 Streptomyces violaceoruber
111 5595362 5595658 + NZ_CP042266.1 Streptomyces qinzhouensis
112 5937449 5937745 + NC_021177.1 Streptomyces fulvissimus DSM 40593
113 6521471 6521767 + NZ_CP047020.1 Streptomyces broussonetiae
114 2684563 2684859 - NZ_CP032698.1 Streptomyces hundungensis
115 1482044 1482340 - NZ_CP012117.1 Dermabacter vaginalis
116 5867681 5867977 + NZ_CP070242.1 Streptomyces californicus
117 4699297 4699593 + NZ_CP017316.1 Streptomyces rubrolavendulae
118 4885716 4886012 + NZ_CP023696.1 Streptomyces fradiae ATCC 10745 = DSM 40063
119 5739246 5739542 + NZ_CP013738.1 Streptomyces globisporus C-1027
120 2870389 2870685 - NZ_AP023440.1 Streptomyces glomeroaurantiacus
121 7271588 7271884 + NZ_CP034463.1 Streptomyces aquilus
122 3807988 3808287 - NZ_CP045929.1 Saccharopolyspora coralli
123 5829268 5829564 + NZ_CP020700.1 Streptomyces tsukubensis
124 2867491 2867787 - NZ_CP023688.1 Streptomyces rimosus
125 3717122 3717436 + NZ_CP038267.1 Nocardioides euryhalodurans
126 2897471 2897767 - NZ_CP051006.1 Streptomyces griseofuscus
127 3057549 3057845 - NZ_CP030073.1 Streptomyces cadmiisoli
128 441526 441801 + NZ_CP041091.1 Nocardioides sambongensis
129 4413045 4413341 + NZ_CP032229.1 Streptomyces seoulensis
130 5573015 5573311 + NZ_CP023703.1 Streptomyces galilaeus
131 5505333 5505629 + NZ_CP010849.1 Streptomyces cyaneogriseus subsp. noncyanogenus
132 2655163 2655459 - NZ_LN831790.1 Streptomyces leeuwenhoekii
133 2307021 2307317 - NZ_CP060404.1 Streptomyces buecherae
134 4605959 4606258 + NZ_CP009922.3 Streptomyces xiamenensis
135 5116571 5116867 + NZ_CP015866.1 Streptomyces parvulus
136 2172240 2172536 - NZ_CP023702.1 Streptomyces nitrosporeus
137 4702219 4702518 + NZ_CP054938.1 Streptomyces harbinensis
138 4089481 4089780 - NC_013510.1 Thermomonospora curvata DSM 43183
139 2655862 2656158 - NC_014830.1 Intrasporangium calvum DSM 43043
140 4647675 4647971 + NZ_CP029254.1 Streptomyces spongiicola
141 7516298 7516594 + NZ_CP065050.1 Streptomyces solisilvae
142 655788 656084 + NC_012803.1 Micrococcus luteus NCTC 2665
143 1725858 1726157 - NZ_CP047186.1 Rathayibacter tanaceti
144 1629800 1630096 + NZ_CP051486.1 Streptomyces pratensis
145 4865738 4866034 + NZ_CP029188.1 Streptomyces tirandamycinicus
146 4280374 4280673 + NZ_CP016793.1 Lentzea guizhouensis
147 4634104 4634400 + NC_016111.1 Streptomyces cattleya NRRL 8057 = DSM 46488
148 5293178 5293474 + NZ_CP072827.1 Streptomyces mobaraensis NBRC 13819 = DSM 40847
149 6618851 6619147 + NZ_CP031455.1 Streptomyces olivoreticuli subsp. olivoreticuli
150 4632758 4633054 - NC_016582.1 Streptomyces bingchenggensis BCW-1
151 7551195 7551491 + NZ_CP045096.1 Streptomyces phaeolivaceus
152 1092505 1092804 - NZ_CP028130.1 Rathayibacter iranicus
153 2424561 2424857 + NZ_AP019307.1 Nocardioides baekrokdamisoli
154 6920994 6921293 - NC_009142.1 Saccharopolyspora erythraea NRRL 2338
155 247539 247811 - NZ_LR214441.1 Tessaracoccus lapidicaptus
156 5213020 5213316 + NZ_CP040752.1 Streptomyces rectiverticillatus
157 3103197 3103493 - NC_013929.1 Streptomyces scabiei 87.22
158 2050431 2050730 - NZ_CP015449.1 Dietzia lutea
159 1334944 1335243 + NZ_CP020715.1 Cnuibacter physcomitrellae
160 985278 985574 + NZ_CP051884.1 Cellulomonas taurus
161 3311673 3311972 - NC_014165.1 Thermobispora bispora DSM 43833
162 7077238 7077534 + NZ_CP034539.1 Streptomyces cyaneochromogenes
163 1505848 1506147 + NZ_CP022752.1 Actinopolyspora erythraea
164 6026470 6026766 + NZ_CP071839.1 Streptomyces cyanogenus
165 3161563 3161859 - NZ_CP023689.1 Streptomyces chartreusis
166 2356729 2357025 - NC_015588.1 Isoptericola variabilis 225
167 1361860 1362132 - NZ_CP019606.1 Tessaracoccus aquimaris
168 2509796 2510095 + NC_013947.1 Stackebrandtia nassauensis DSM 44728
169 2670230 2670469 - NZ_CP026734.1 Brevibacterium linens
170 5131747 5132046 + NZ_AP022871.1 Phytohabitans suffuscus
171 3381350 3381646 - NZ_CP041694.1 Cellulosimicrobium cellulans
172 7993887 7994186 - NC_019673.1 Saccharothrix espanaensis DSM 44229
173 997474 997773 + NZ_CP071883.1 Curtobacterium flaccumfaciens pv. flaccumfaciens
174 6948104 6948403 - NZ_CP023445.1 Actinosynnema pretiosum
175 825194 825490 + NZ_CP038213.1 Ornithinimicrobium flavum
176 7087156 7087455 - NC_013093.1 Actinosynnema mirum DSM 43827
177 8998022 8998321 + NZ_AP022870.1 Phytohabitans flavus
178 5654741 5654983 - NZ_CP022521.1 Actinoalloteichus hoggarensis
179 1521060 1521359 - NZ_CP043661.1 Kribbella qitaiheensis
180 3994250 3994546 - NZ_CP011112.1 Luteipulveratus mongoliensis
181 1705597 1705893 - NZ_CP035495.1 Xylanimonas allomyrinae
182 1012251 1012568 + NC_022438.1 Leifsonia xyli subsp. cynodontis DSM 46306
183 3279791 3280063 + NZ_CP019607.1 Tessaracoccus flavescens
184 6153612 6153854 - NZ_CP016076.1 Actinoalloteichus fjordicus
185 9628468 9628767 - NZ_CP034550.1 Saccharothrix syringae
186 5280434 5280733 - NC_013729.1 Kribbella flavida DSM 17836
187 1793464 1793706 + NC_022116.1 Amycolatopsis mediterranei RB
188 1235537 1235836 + NC_013521.1 Sanguibacter keddieii DSM 10542
189 31450 31749 - NZ_CP032624.1 Gryllotalpicola protaetiae
190 2687250 2687546 - NZ_CP045529.1 Luteimicrobium xylanilyticum
191 1822098 1822373 + NZ_CP018762.1 Microbacterium aurum
192 57209 57505 + NZ_CP014209.1 Isoptericola dokdonensis DS-3
193 2838709 2838948 - NZ_CP025333.1 Brevibacterium aurantiacum
194 1845909 1846208 - NZ_CP058670.1 Chryseoglobus indicus
195 1720074 1720373 - NZ_CP031423.1 Microbacterium lemovicicum
196 1723608 1723907 + NZ_CP025198.1 Acidipropionibacterium virtanenii
197 1328990 1329286 - NZ_CP014989.1 Serinicoccus hydrothermalis
198 4354386 4354628 - NC_007777.1 Frankia casuarinae
199 3621164 3621463 - NZ_CP035494.1 Microbacterium protaetiae
200 5663635 5663958 - NZ_AP018920.1 Pseudonocardia autotrophica
201 554924 555220 + NZ_CP007490.1 Rhodoluna lacicola
202 2962443 2962742 + NZ_CP061344.1 Microbacterium hominis
203 3174461 3174736 - NC_015635.1 Microlunatus phosphovorus NM-1
204 1832964 1833266 - NZ_CP028913.1 Agromyces badenianii
205 1893625 1893948 + NC_015312.1 Pseudonocardia dioxanivorans CB1190
206 2133075 2133374 - NZ_CP015453.1 Dietzia psychralcaliphila
207 4339808 4340104 - NZ_CP015163.1 Amycolatopsis albispora
208 949244 949540 + NZ_CP013290.1 Janibacter indicus
209 713157 713453 + NZ_CP040887.1 Serinicoccus chungangensis
210 2362276 2362521 + NZ_LT996886.1 Tessaracoccus timonensis
211 1226853 1227107 + NZ_CP011853.1 Gordonia phthalatica
212 2599762 2600058 - NC_013530.1 Xylanimonas cellulosilytica DSM 15894
213 2997842 2998144 + NZ_CP053564.1 Pseudonocardia broussonetiae
214 1996679 1996981 + NZ_CP013979.1 Agromyces aureus
215 1576297 1576593 + NC_012669.1 Beutenbergia cavernae DSM 12333
216 791295 791591 - NZ_LT635457.1 Actinomyces pacaensis
217 4908776 4909033 - NZ_CP041695.1 Nocardia otitidiscaviarum
218 2014885 2015160 - NZ_CP031422.1 Microbacterium oxydans
219 240194 240493 + NZ_CP049253.1 Microbacterium amylolyticum
220 1691143 1691403 + NZ_CP031425.1 Microbacterium foliorum
221 72871 73176 + NZ_CP035810.1 Brevibacterium luteolum
222 1295836 1296135 + NZ_CP038256.1 Microbacterium sediminis
223 2053130 2053429 - NZ_CP044232.1 Microbacterium lushaniae
224 529510 529809 - NZ_CP019400.1 Acidipropionibacterium acidipropionici
225 703627 703923 + NZ_CP044427.1 Ornithinimicrobium pratense
226 1852713 1853009 - NZ_LS483423.1 Jonesia denitrificans
227 8747016 8747315 + NZ_CP022088.2 Nocardia brasiliensis
228 1466374 1466673 + NZ_CP044231.1 Microbacterium caowuchunii
229 2413383 2413685 + NZ_CP035491.1 Agromyces protaetiae
230 2487802 2488110 - NZ_CP026952.1 Aeromicrobium chenweiae
231 9347577 9347876 - NZ_CP045572.1 Nonomuraea nitratireducens
232 875240 875536 - NZ_CP040508.1 Rhodoluna limnophila
233 2095676 2095975 - NZ_CP038266.1 Microbacterium wangchenii
234 758295 758591 + NC_008578.1 Acidothermus cellulolyticus 11B
235 1268287 1268535 + NC_014666.1 Frankia inefficax
236 1248553 1248849 + NC_014151.1 Cellulomonas flavigena DSM 20109
237 3562445 3562744 - NZ_CP027793.1 Rhodococcus hoagii
238 610419 610718 + NZ_CP026923.1 Pontimonas salivibrio
239 2714105 2714404 - NZ_CP039291.1 Cellulomonas shaoxiangyii
240 8895713 8896012 - NC_013595.1 Streptosporangium roseum DSM 43021
241 3431366 3431689 - NC_016906.1 Gordonia polyisoprenivorans VH2
242 1611618 1611911 + NC_013235.1 Nakamurella multipartita DSM 44233
243 3537240 3537539 + NZ_CP026746.1 Nocardia cyriacigeorgica
244 2525914 2526213 + NZ_CP015079.1 Nocardioides dokdonensis FR1436
245 3474705 3475016 - NC_013441.1 Gordonia bronchialis DSM 43247
246 1055333 1055629 - NZ_CP066065.1 Schaalia meyeri
247 2149760 2150014 + NZ_AP023396.1 Nocardia wallacei
248 4413099 4413398 - NC_006361.1 Nocardia farcinica IFM 10152
249 2647964 2648263 - NC_015671.1 Cellulomonas gilvus ATCC 13127
250 3511914 3512153 - NZ_CP065682.1 Brevibacterium casei
251 2602290 2602589 - NZ_CP033325.1 Georgenia faecalis
252 2455296 2455595 + NZ_AP023172.1 Rhodococcus qingshengii
253 1031487 1031786 - NZ_CP032788.1 Corynebacterium xerosis
254 3758874 3759131 - NZ_CP022208.1 Rhodococcus pyridinivorans
255 3417058 3417315 - NZ_LT906450.1 Rhodococcus rhodochrous
256 2496041 2496298 + NZ_CP027114.1 Gordonia alkanivorans
257 2654609 2654857 + NZ_CP059694.1 Gordonia rubripertincta
258 3042993 3043292 - NC_015514.1 Cellulomonas fimi ATCC 484
259 4976774 4977013 - NZ_CP018082.1 Nocardia mangyaensis
260 3287400 3287657 - NC_015564.1 Hoyosella subflava DQS3-9A1
261 5017977 5018225 - NZ_CP015235.1 Rhodococcus fascians D188
262 2219742 2220017 + NZ_CP032630.1 Protaetiibacter intestinalis
263 5849862 5850101 - NZ_LR134352.1 Nocardia asteroides
264 2202695 2202994 - NZ_CP061007.1 Saccharopolyspora spinosa
265 1383078 1383326 + NZ_CP016353.1 Prauserella marina
266 2166111 2166353 + NZ_AP017900.1 Nocardia seriolae
267 1003263 1003523 + NZ_CP060789.1 Tessaracoccus defluvii
268 3114906 3115217 - NZ_CP027433.1 Gordonia iterans
269 1212453 1212752 - NZ_CP034438.1 Flaviflexus salsibiostraticola
270 6344131 6344373 - NC_008278.1 Frankia alni ACN14a
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP018863.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01425.23 1.0 269 3 same-strand Amidase
2 PF02934.17 0.91 247 1600 same-strand GatB/GatE catalytic domain
3 PF02637.20 0.91 247 1602 same-strand GatB domain
4 PF01653.20 0.67 181 2695 same-strand NAD-dependent DNA ligase adenylation domain
5 PF03120.18 0.75 203 2694 same-strand NAD-dependent DNA ligase OB-fold domain
6 PF12826.9 0.74 199 2695 same-strand Helix-hairpin-helix motif
7 PF00533.28 0.75 203 2694 same-strand BRCA1 C Terminus (BRCT) domain
8 PF03119.18 0.75 203 2694 same-strand NAD-dependent DNA ligase C4 zinc finger domain
9 PF14520.8 0.71 191 2696 same-strand Helix-hairpin-helix domain
++ More..