Result : EXP04052
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04052 |
| NCBI Accession ID | |
| Organism | Lachnoanaerobaculum |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | TTGAGTGAGAGCGAATATAATAAGCTTGAAAAAGCGGAAAAGAATAATGAGTATCTGGCAAAGATAGCTGAATCAATAAAACAGCTTGAAGAGGGGAAAATTGTTGTTAAAACAATAGACGGGTTAGAGGATATGGCTGAATGA |
| Sequence | MSESEYNKLEKAEKNNEYLAKIAESIKQLEEGKIVVKTIDGLEDMAE |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 153589 | 153735 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 2 | 3425399 | 3425551 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 3 | 948029 | 948169 | + | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015437.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06769.16 | 0.67 | 2 | -5.0 | same-strand | YoeB-like toxin of bacterial type II toxin-antitoxin system |
++ More..