Result : EXP04046
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04046 |
| NCBI Accession ID | |
| Organism | Faecalibacterium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGCACATAAAAAGGGCGTAGGCAGCACCAAGAACGGCCGCGATTCCGCAGCACAGCGTCTGGGCACAAAGCGTGCAGACGGTCAGTTCGTTCTGGCCGGCAACATCCTCGTTCGTCAGCGTGGCACCCACATTCATGCCGGGTGA |
| Sequence | MAHKKGVGSTKNGRDSAAQRLGTKRADGQFVLAGNILVRQRGTHIHAG |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5709503 | 5709649 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 2 | 415258 | 415377 | + | NZ_CP059674.1 | Mycoplasma tullyi |
| 3 | 477053 | 477172 | + | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP059674.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.67 | 2 | 838 | same-strand | ABC transporter |
| 2 | PF00829.23 | 0.67 | 2 | 381.5 | same-strand | Ribosomal prokaryotic L21 protein |
| 3 | PF04327.14 | 0.67 | 2 | 56.0 | same-strand | Cysteine protease Prp |
| 4 | PF01261.26 | 0.67 | 2 | 193.0 | same-strand | Xylose isomerase-like TIM barrel |
++ More..