Result : C0H3Z8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein XkzB |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1334815 |
| Right | 1334964 |
| Strand | + |
| Nucleotide Sequence | TTGTACTATGCAATGCATGAGCTTCATTACTCGCCATCCCAACTTCTTGAATTATATGAAGCACCAAAACATTTTAAAGCTCTTTTATTTGGGTTGATAGGTTATAAGCTAGATCTATTAGAAAAAGAATCAAGGAGAGGAGGGAACTAA |
| Sequence | MYYAMHELHYSPSQLLELYEAPKHFKALLFGLIGYKLDLLEKESRRGGN |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3Z8 |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1334815 | 1334964 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2677466 | 2677603 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 651057 | 651206 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 1308162 | 1308311 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 1252193 | 1252342 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 1342304 | 1342444 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1256979 | 1257131 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 8 | 2704100 | 2704252 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2805268 | 2805405 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 10 | 1192643 | 1192777 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 11 | 1303281 | 1303421 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 12 | 1502534 | 1502674 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 13 | 2504679 | 2504816 | + | NZ_CP043404.1 | Bacillus safensis |
| 14 | 2599556 | 2599693 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 1332801 | 1332938 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 16 | 1434724 | 1434861 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 17 | 2254234 | 2254383 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04883.14 | 0.67 | 10 | 3093 | same-strand | Bacteriophage HK97-gp10, putative tail-component |
| 2 | PF04984.16 | 1.0 | 15 | 1023 | same-strand | Phage tail sheath protein subtilisin-like domain |
| 3 | PF17482.4 | 1.0 | 15 | 1023 | same-strand | Phage tail sheath C-terminal domain |
| 4 | PF17481.4 | 0.87 | 13 | 1024 | same-strand | Phage tail sheath protein beta-sandwich domain |
| 5 | PF09393.12 | 1.0 | 15 | 578 | same-strand | Phage tail tube protein |
| 6 | PF08890.13 | 1.0 | 15 | 42 | same-strand | Phage XkdN-like tail assembly chaperone protein, TAC |
| 7 | PF01464.22 | 0.93 | 14 | 4.0 | same-strand | Transglycosylase SLT domain |
| 8 | PF01476.22 | 1.0 | 15 | 4157 | same-strand | LysM domain |
| 9 | PF10934.10 | 1.0 | 15 | 6125 | same-strand | Protein of unknown function (DUF2634) |
++ More..