Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein XkzB |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 1334815 |
Right | 1334964 |
Strand | + |
Nucleotide Sequence | TTGTACTATGCAATGCATGAGCTTCATTACTCGCCATCCCAACTTCTTGAATTATATGAAGCACCAAAACATTTTAAAGCTCTTTTATTTGGGTTGATAGGTTATAAGCTAGATCTATTAGAAAAAGAATCAAGGAGAGGAGGGAACTAA |
Sequence | MYYAMHELHYSPSQLLELYEAPKHFKALLFGLIGYKLDLLEKESRRGGN |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | C0H3Z8 |
ORF Length (Amino Acid) | 49 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1334815 | 1334964 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 2677466 | 2677603 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
3 | 651057 | 651206 | - | NZ_CP029364.1 | Bacillus halotolerans |
4 | 1308162 | 1308311 | + | NZ_CP013984.1 | Bacillus inaquosorum |
5 | 1252193 | 1252342 | + | NZ_CP048852.1 | Bacillus tequilensis |
6 | 1342304 | 1342444 | + | NZ_CP051464.1 | Bacillus mojavensis |
7 | 1256979 | 1257131 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
8 | 2704100 | 2704252 | - | NZ_CP011937.1 | Bacillus velezensis |
9 | 2805268 | 2805405 | - | NZ_CP011150.1 | Bacillus altitudinis |
10 | 1192643 | 1192777 | + | NZ_CP011150.1 | Bacillus altitudinis |
11 | 1303281 | 1303421 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
12 | 1502534 | 1502674 | + | NZ_CP033052.1 | Bacillus vallismortis |
13 | 2504679 | 2504816 | + | NZ_CP043404.1 | Bacillus safensis |
14 | 2599556 | 2599693 | + | NZ_CP017786.1 | Bacillus xiamenensis |
15 | 1332801 | 1332938 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
16 | 1434724 | 1434861 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
17 | 2254234 | 2254383 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04883.14 | 0.67 | 10 | 3093 | same-strand | Bacteriophage HK97-gp10, putative tail-component |
2 | PF04984.16 | 1.0 | 15 | 1023 | same-strand | Phage tail sheath protein subtilisin-like domain |
3 | PF17482.4 | 1.0 | 15 | 1023 | same-strand | Phage tail sheath C-terminal domain |
4 | PF17481.4 | 0.87 | 13 | 1024 | same-strand | Phage tail sheath protein beta-sandwich domain |
5 | PF09393.12 | 1.0 | 15 | 578 | same-strand | Phage tail tube protein |
6 | PF08890.13 | 1.0 | 15 | 42 | same-strand | Phage XkdN-like tail assembly chaperone protein, TAC |
7 | PF01464.22 | 0.93 | 14 | 4.0 | same-strand | Transglycosylase SLT domain |
8 | PF01476.22 | 1.0 | 15 | 4157 | same-strand | LysM domain |
9 | PF10934.10 | 1.0 | 15 | 6125 | same-strand | Protein of unknown function (DUF2634) |