Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YkzM |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 1332187 |
Right | 1332405 |
Strand | + |
Nucleotide Sequence | GTGTCAAAGGACAAACAACAGAAGAAGGCTGTACATACAAAGAGCCGGGAAGCTCTATTTGATACAGCGGATTTGATTAAGCACGCGAAGGAACTGTTCGGCGTTAAGCCGGATATTCTTCAGGGGGCTTTATTTGGCGTGGATCAACCACGTATGACGAAATCAGAAGCCAACCAATTGATTCAAACATTTCTAACCAAGGAGGTCATGTCATCATGA |
Sequence | MSKDKQQKKAVHTKSREALFDTADLIKHAKELFGVKPDILQGALFGVDQPRMTKSEANQLIQTFLTKEVMSS |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | C0H3Z7 |
ORF Length (Amino Acid) | 72 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1332187 | 1332405 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1305535 | 1305753 | + | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 1300642 | 1300860 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
4 | 1499898 | 1500116 | + | NZ_CP033052.1 | Bacillus vallismortis |
5 | 1249563 | 1249781 | + | NZ_CP048852.1 | Bacillus tequilensis |
6 | 653617 | 653829 | - | NZ_CP029364.1 | Bacillus halotolerans |
7 | 1339669 | 1339881 | + | NZ_CP051464.1 | Bacillus mojavensis |
8 | 1254363 | 1254572 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
9 | 2706658 | 2706867 | - | NZ_CP011937.1 | Bacillus velezensis |
10 | 1189635 | 1189859 | + | NZ_CP011150.1 | Bacillus altitudinis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05065.15 | 0.9 | 9 | 1697 | same-strand | Phage capsid family |
2 | PF11436.10 | 1.0 | 10 | 1293.0 | same-strand | Protein of unknown function (DUF3199) |
3 | PF12206.10 | 1.0 | 10 | 940.0 | same-strand | Domain of unknown function (DUF3599) |
4 | PF04883.14 | 1.0 | 10 | 456.5 | same-strand | Bacteriophage HK97-gp10, putative tail-component |
5 | PF04984.16 | 1.0 | 10 | -1.5 | same-strand | Phage tail sheath protein subtilisin-like domain |
6 | PF17482.4 | 1.0 | 10 | -1.5 | same-strand | Phage tail sheath C-terminal domain |
7 | PF17481.4 | 0.8 | 8 | -3.0 | same-strand | Phage tail sheath protein beta-sandwich domain |
8 | PF09393.12 | 1.0 | 10 | 1399.0 | same-strand | Phage tail tube protein |
9 | PF08890.13 | 1.0 | 10 | 1933.5 | same-strand | Phage XkdN-like tail assembly chaperone protein, TAC |
10 | PF01464.22 | 1.0 | 10 | 2654.0 | same-strand | Transglycosylase SLT domain |
11 | PF01476.22 | 0.7 | 7 | 6580 | same-strand | LysM domain |