Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YkzK |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 1323550 |
Right | 1323717 |
Strand | + |
Nucleotide Sequence | ATGTGTAAGCTTTGTCAAACAAAGAAAGTCATTGTGGAACATACCGGTATTGGAGTTGTTTTTCATCCATGTCCGAACTGCCGGTCCGGCACTGACTTAACGCCTGTCATTCAAAAGCTGGAGCAAATGCTGACAGCGGGAAAAGCGAGGCTGAATATCTATGATTAA |
Sequence | MCKLCQTKKVIVEHTGIGVVFHPCPNCRSGTDLTPVIQKLEQMLTAGKARLNIYD |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | C0H3Z5 |
ORF Length (Amino Acid) | 55 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1323550 | 1323717 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1296900 | 1297067 | + | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 1240927 | 1241094 | + | NZ_CP048852.1 | Bacillus tequilensis |
4 | 662298 | 662465 | - | NZ_CP029364.1 | Bacillus halotolerans |
5 | 1491260 | 1491427 | + | NZ_CP033052.1 | Bacillus vallismortis |
6 | 1331031 | 1331198 | + | NZ_CP051464.1 | Bacillus mojavensis |
7 | 1292009 | 1292176 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
8 | 2715283 | 2715450 | - | NZ_CP011937.1 | Bacillus velezensis |
9 | 1245774 | 1245941 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06114.15 | 1.0 | 9 | 2383 | opposite-strand | IrrE N-terminal-like domain |
2 | PF01381.24 | 1.0 | 9 | 1881 | opposite-strand | Helix-turn-helix |
3 | PF12844.9 | 1.0 | 9 | 1881 | opposite-strand | Helix-turn-helix domain |
4 | PF13560.8 | 1.0 | 9 | 1881 | opposite-strand | Helix-turn-helix domain |
5 | PF17356.4 | 1.0 | 9 | 431 | same-strand | Phage-like element PBSX protein XtrA |
6 | PF08281.14 | 1.0 | 9 | 752 | same-strand | Sigma-70, region 4 |
7 | PF04545.18 | 1.0 | 9 | 752 | same-strand | Sigma-70, region 4 |
8 | PF03592.18 | 1.0 | 9 | 1379 | same-strand | Terminase small subunit |
9 | PF04466.15 | 0.78 | 7 | 2169 | same-strand | Phage terminase large subunit |
10 | PF17288.4 | 0.78 | 7 | 2169 | same-strand | Terminase RNAseH like domain |