Result : EXP04010
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP04010 |
| NCBI Accession ID | |
| Organism | Bacteroides |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGACTTTTGTAAAAGATAACAAGATATGGTTGATAAAAGACGTTTCTGTTATTCCTAAAAGTAAAAGGGAATTCTTCTGGAAAAGATTTATGATAGGATGTATCATCGGAATAGGAGTGACATTGCTGGTTCTGTTTTATTAA |
| Sequence | MTFVKDNKIWLIKDVSVIPKSKREFFWKRFMIGCIIGIGVTLLVLFY |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1717446 | 1717589 | - | NZ_LR699004.1 | Phocaeicola dorei |
| 2 | 1543406 | 1543531 | + | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR699004.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13603.8 | 1.0 | 2 | 2487.0 | opposite-strand | Leucyl-tRNA synthetase, Domain 2 |
| 2 | PF08264.15 | 1.0 | 2 | 2487.0 | opposite-strand | Anticodon-binding domain of tRNA ligase |
| 3 | PF02588.17 | 1.0 | 2 | 1508.5 | opposite-strand | Uncharacterised 5xTM membrane BCR, YitT family COG1284 |
| 4 | PF10035.11 | 1.0 | 2 | 1508.5 | opposite-strand | Uncharacterized protein conserved in bacteria (DUF2179) |
| 5 | PF13302.9 | 1.0 | 2 | 849.5 | same-strand | Acetyltransferase (GNAT) domain |
| 6 | PF00583.27 | 1.0 | 2 | 849.5 | same-strand | Acetyltransferase (GNAT) family |
| 7 | PF01725.18 | 1.0 | 2 | 138.5 | opposite-strand | Ham1 family |
| 8 | PF02445.18 | 1.0 | 2 | -3.0 | same-strand | Quinolinate synthetase A protein |
| 9 | PF00588.21 | 1.0 | 2 | 2851.5 | opposite-strand | SpoU rRNA Methylase family |
| 10 | PF14127.8 | 1.0 | 2 | 3418.5 | same-strand | Domain of unknown function (DUF4294) |
| 11 | PF12836.9 | 1.0 | 2 | 4087.5 | opposite-strand | Helix-hairpin-helix motif |
++ More..