Protein name |
EXP04007 |
NCBI Accession ID |
|
Organism |
Eubacterium,Roseburia,Eisenbergiella |
Left |
|
Right |
|
Strand |
|
Nucleotide Sequence |
ATGGCAACTGTAATTGTAGCAATCATTGTATTTGGACTGGTTGGTCTGATTATCGGTAAAGGCATTTATGATAAAAAACACCATAAGGGCGGTTGCGGTTGCAATTGCTCATCCTGCGGTGGCGGATGCCACTCACAGAAATAA |
Sequence |
MATVIVAIIVFGLVGLIIGKGIYDKKHHKGGCGCNCSSCGGGCHSQK |
Source of smORF |
Metagenomic Ribo-seq |
Function |
The ORF matches to the profile of pfam12669. Profile Description: Virus attachment protein p12 family. This family of proteins are related to Virus attachment protein p12 from the African swine fever virus. The family appears to contain an N-terminal signal peptide followed by a short cysteine rich region. The cysteine rich region is extremely variable and it is possible that only the N-terminal region is homologous. |
Pubmed ID |
32601270
|
Domain |
CDD:403765 |
Functional Category |
Conserved domain based functional assignment |
Uniprot ID |
|
ORF Length (Amino Acid) |
47 |