Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YjzJ |
NCBI Accession ID | AL009126.3 |
Organism | Bacillus subtilis (strain 168) |
Left | 1321848 |
Right | 1322027 |
Strand | + |
Nucleotide Sequence | ATGTATCCGATCCAAATCGTTTTTAGTGAAAATCCCATAGATCAGCGCCATCTCGGACAATCCGGCGGCACCATTTCGTTTACCGCATGCGGCCTTCCGGTGTTTCACTTTGAAACGCAGGAACAGTTTCAAGCATACATGATGTTAAAAGGAGAAGCGGCGTACAATGAAAAACGATAA |
Sequence | MYPIQIVFSENPIDQRHLGQSGGTISFTACGLPVFHFETQEQFQAYMMLKGEAAYNEKR |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | C0H3Z4 |
ORF Length (Amino Acid) | 59 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1321848 | 1322027 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1290307 | 1290486 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
3 | 1489558 | 1489737 | + | NZ_CP033052.1 | Bacillus vallismortis |
4 | 1295198 | 1295377 | + | NZ_CP013984.1 | Bacillus inaquosorum |
5 | 1329329 | 1329508 | + | NZ_CP051464.1 | Bacillus mojavensis |
6 | 1239225 | 1239404 | + | NZ_CP048852.1 | Bacillus tequilensis |
7 | 663988 | 664167 | - | NZ_CP029364.1 | Bacillus halotolerans |
8 | 2716967 | 2717146 | - | NZ_CP011937.1 | Bacillus velezensis |
9 | 1244078 | 1244257 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF08000.13 | 0.78 | 7 | 2940 | opposite-strand | Bacterial PH domain |
2 | PF05908.13 | 1.0 | 9 | 2229 | same-strand | Poly-gamma-glutamate hydrolase |
3 | PF05067.14 | 0.67 | 6 | 1323.5 | same-strand | Manganese containing catalase |
4 | PF06114.15 | 1.0 | 9 | 681 | opposite-strand | IrrE N-terminal-like domain |
5 | PF01381.24 | 1.0 | 9 | 179 | opposite-strand | Helix-turn-helix |
6 | PF12844.9 | 1.0 | 9 | 179 | opposite-strand | Helix-turn-helix domain |
7 | PF13560.8 | 1.0 | 9 | 179 | opposite-strand | Helix-turn-helix domain |
8 | PF17356.4 | 0.78 | 7 | 2121 | same-strand | Phage-like element PBSX protein XtrA |