Protein Information |
Information Type | Description |
---|---|
Protein name | EXP04002 |
NCBI Accession ID | |
Organism | Azospirillum |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGGGAACAGCAATCGTACTTCTTGTGTTATGTATCATTGTTGGTGCAGTCATTTACAAGATGGTTAAGGATAAACGAAGTGGGAAATCCTCATGTGGCGGCAACTGTGTCGGATGCGGTATGGCCTGTCACCAGTCAAAAGAGATGAAATAG |
Sequence | MGTAIVLLVLCIIVGAVIYKMVKDKRSGKSSCGGNCVGCGMACHQSKEMK |
Source of smORF | Metagenomic Ribo-seq |
Function | The ORF matches to the profile of pfam12669. Profile Description: Virus attachment protein p12 family. This family of proteins are related to Virus attachment protein p12 from the African swine fever virus. The family appears to contain an N-terminal signal peptide followed by a short cysteine rich region. The cysteine rich region is extremely variable and it is possible that only the N-terminal region is homologous. |
Pubmed ID | 32601270 |
Domain | CDD:403765 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 50 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1731451 | 1731591 | + | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
2 | 2408976 | 2409107 | + | NZ_CP039126.1 | Blautia producta |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04023.16 | 1.0 | 2 | 2515.0 | same-strand | FeoA domain |
2 | PF02421.20 | 1.0 | 2 | 85.0 | same-strand | Ferrous iron transport protein B |
3 | PF07670.16 | 1.0 | 2 | 85.0 | same-strand | Nucleoside recognition |
4 | PF07664.14 | 1.0 | 2 | 85.0 | same-strand | Ferrous iron transport protein B C terminus |
5 | PF01926.25 | 1.0 | 2 | 85.0 | same-strand | 50S ribosome-binding GTPase |
6 | PF17910.3 | 1.0 | 2 | 85.0 | same-strand | FeoB cytosolic helical domain |