Result : EXP03987
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03987 |
| NCBI Accession ID | |
| Organism | Bacteroides |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGACCGTAATACAAACAGATCAAAAGGTTTTGCCTTCGTAGAGATGCCCGAAGCTGCTGAAGCCCAACAAGCAATCAACAAACTGAATGGAGCAGAATATGTAGGCCGCCAAATGGTAGTGAAAGAAGCATTGCCAAGAAACTAA |
| Sequence | MDRNTNRSKGFAFVEMPEAAEAQQAINKLNGAEYVGRQMVVKEALPRN |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 57
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 320005 | 320151 | - | NZ_CP015401.2 | Bacteroides caecimuris |
| 2 | 5142832 | 5142978 | - | NZ_CP012938.1 | Bacteroides ovatus |
| 3 | 4569217 | 4569363 | + | NZ_LN877293.1 | Bacteroides fragilis |
| 4 | 2296893 | 2297039 | - | NZ_CP040530.1 | Bacteroides thetaiotaomicron |
| 5 | 838892 | 839038 | - | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 6 | 603090 | 603254 | + | NC_014655.1 | Leadbetterella byssophila DSM 17132 |
| 7 | 1408389 | 1408547 | + | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 8 | 1126177 | 1126350 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 9 | 1297304 | 1297471 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 10 | 1171336 | 1171500 | - | NZ_CP042433.1 | Flavisolibacter ginsenosidimutans |
| 11 | 121386 | 121538 | - | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 12 | 107885 | 108052 | + | NZ_CP032097.1 | Arcobacter ellisii |
| 13 | 1208796 | 1208948 | + | NZ_CP018799.1 | Mariprofundus aestuarium |
| 14 | 199022 | 199192 | - | NZ_CP018799.1 | Mariprofundus aestuarium |
| 15 | 3982759 | 3982923 | - | NZ_CP014476.1 | Methylomonas denitrificans |
| 16 | 127299 | 127466 | + | NZ_CP053835.1 | Arcobacter defluvii |
| 17 | 4033531 | 4033683 | + | NZ_CP013118.1 | Salinivirga cyanobacteriivorans |
| 18 | 1576477 | 1576605 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 19 | 2014594 | 2014722 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 20 | 180068 | 180229 | + | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 21 | 70442 | 70609 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 22 | 63172 | 63339 | + | NZ_CP030944.1 | Arcobacter aquimarinus |
| 23 | 124390 | 124557 | + | NZ_CP053840.1 | Arcobacter venerupis |
| 24 | 104385 | 104552 | + | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 25 | 132926 | 133093 | + | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 26 | 62296 | 62463 | + | NZ_CP053833.1 | Arcobacter cloacae |
| 27 | 227117 | 227290 | - | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 28 | 4366600 | 4366773 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 29 | 1629837 | 1630004 | + | NZ_CP036259.1 | Sporomusa termitida |
| 30 | 1420652 | 1420822 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 31 | 2468506 | 2468655 | + | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 32 | 2669859 | 2670026 | - | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 33 | 3603391 | 3603552 | + | NZ_CP044399.1 | Moritella marina ATCC 15381 |
| 34 | 1878155 | 1878313 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 35 | 2241083 | 2241253 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 36 | 716464 | 716619 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 37 | 1766515 | 1766664 | + | NZ_CP012418.1 | Kangiella sediminilitoris |
| 38 | 2820751 | 2820906 | + | NZ_AP018724.1 | Sulfurivermis fontis |
| 39 | 307228 | 307395 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 40 | 6251013 | 6251174 | - | NZ_CP065050.1 | Streptomyces solisilvae |
| 41 | 2691885 | 2692046 | + | NZ_LS483250.1 | Moritella yayanosii |
| 42 | 514644 | 514805 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 43 | 718909 | 719067 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 44 | 137342 | 137515 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 45 | 470726 | 470884 | + | NZ_CP035689.1 | Vibrio metoecus |
| 46 | 1852560 | 1852715 | + | NZ_CP025120.1 | Kangiella profundi |
| 47 | 4346599 | 4346751 | - | NC_007912.1 | Saccharophagus degradans 2-40 |
| 48 | 3901906 | 3902052 | + | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 49 | 573055 | 573213 | + | NZ_CP049801.1 | Acinetobacter shaoyimingii |
| 50 | 987341 | 987496 | + | NZ_CP071766.1 | Acinetobacter towneri |
| 51 | 2218045 | 2218194 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 52 | 2573411 | 2573581 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 53 | 1913262 | 1913405 | + | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 54 | 811618 | 811764 | - | NZ_CP031222.1 | Aquirhabdus parva |
| 55 | 2666707 | 2666862 | - | NZ_CP044483.1 | Acinetobacter schindleri |
| 56 | 391520 | 391684 | - | NZ_CP034015.1 | Shewanella livingstonensis |
| 57 | 4373028 | 4373192 | + | NZ_CP041036.1 | Shewanella polaris |
| 58 | 1961782 | 1961955 | - | NZ_CP013816.1 | Piscirickettsia salmonis |
| 59 | 2995617 | 2995769 | - | NZ_CP035934.2 | Acinetobacter cumulans |
| 60 | 4745204 | 4745368 | + | NZ_CP046378.1 | Shewanella algae |
++ More..