Result : C0H3Z2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YjzH |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1278205 |
| Right | 1278399 |
| Strand | - |
| Nucleotide Sequence | ATGAAAGAATATGAATTCGTAAGAGTTGAGCTGAGTACGATGAGAAGAAGGCCTAAAGAAGACTACCAGCAAATCATCCATGATTATGCGAAAAGAGGCTGGAGATTCGTTCAGATTTTCGCTCCCAGTATAGATGGGTATGGGGCAGCTGCTTATTTTGAAATCATATTTGAAAGGGATGCGGAAAAAGCTTAA |
| Sequence | MKEYEFVRVELSTMRRRPKEDYQQIIHDYAKRGWRFVQIFAPSIDGYGAAAYFEIIFERDAEKA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam13783. Profile Description: Domain of unknown function (DUF4177). |
| Pubmed ID | 9384377 |
| Domain | CDD:404641 |
| Functional Category | Others |
| Uniprot ID | C0H3Z2 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1278205 | 1278399 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1252702 | 1252896 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1206410 | 1206604 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 1246663 | 1246857 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 707441 | 707635 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 1286591 | 1286785 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 2148331 | 2148516 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 8 | 4036567 | 4036755 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 9 | 2216248 | 2216436 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 10 | 4363942 | 4364130 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 11 | 3206731 | 3206925 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 12 | 4544380 | 4544577 | + | NC_011725.1 | Bacillus cereus B4264 |
++ More..