Result : EXP03981
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03981 |
| NCBI Accession ID | |
| Organism | Eubacterium,Agrococcus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGTCTGATATTGAACACAGCAAGGACTTTGACAAGATCAAGAGATGGTACGACAATGGCCTGTGGAAGGTCAAGCACGTTCGCGCTGCTGTCGGCAAGAAGATCACCGCCGATGAGTTCAAGGAGATCACGGGCGAGGACTACTAA |
| Sequence | MSDIEHSKDFDKIKRWYDNGLWKVKHVRAAVGKKITADEFKEITGEDY |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl23995. Profile Description: Phage uncharacterized protein (Phage_XkdX). This model represents a family of small (about 50 amino acid) phage proteins, found in at least 12 different phage and prophage regions of Gram-positive bacteria. In a number of these phage, the gene for this protein is found near the holin and endolysin genes. [Mobile and extrachromosomal element functions, Prophage functions] |
| Pubmed ID | 32601270 |
| Domain | CDD:420140 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 931339 | 931479 | + | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 2 | 815922 | 816074 | + | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 3 | 626492 | 626626 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014376.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05105.14 | 0.67 | 2 | 359.5 | same-strand | Bacteriophage holin family |
++ More..