Result : EXP03969
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03969 |
| NCBI Accession ID | |
| Organism | Ruminococcus,Roseburia,Oscillibacter |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGTTTTTTCGGCTCGTAAATCAAATGGCAAAAAGTGAAGGTGTGAACGAACAACTTAAAGTGTCAAATGCAATGCTGTGGGTACAAAAAATGAATAATATTCGCAACAAAGTATCTGAAATTATAAATGCAGAAGTTATATTTCCCGAGTGA |
| Sequence | MFFRLVNQMAKSEGVNEQLKVSNAMLWVQKMNNIRNKVSEIINAEVIFPE |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 838982 | 839131 | + | NZ_CP006712.1 | Bifidobacterium breve JCM 7017 |
| 2 | 1585791 | 1585940 | - | NZ_LR699011.1 | Roseburia hominis |
| 3 | 3291400 | 3291525 | - | NZ_LR699011.1 | Roseburia hominis |
| 4 | 2667943 | 2668092 | - | NZ_CP070062.1 | Coprococcus comes |
| 5 | 1336284 | 1336409 | - | NZ_CP070062.1 | Coprococcus comes |
| 6 | 733674 | 733799 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 7 | 1934988 | 1935113 | - | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 8 | 2221033 | 2221182 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 9 | 483836 | 483970 | + | NC_014624.2 | Eubacterium callanderi |
| 10 | 72562 | 72687 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 11 | 103368 | 103493 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 12 | 3075886 | 3076011 | + | NZ_CP048436.1 | Flavonifractor plautii |
| 13 | 1255438 | 1255563 | - | NZ_CP029256.1 | Christensenella minuta |
| 14 | 548588 | 548731 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 15 | 2255851 | 2255976 | - | NZ_CP048649.1 | Aminipila butyrica |
| 16 | 1467572 | 1467697 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 17 | 3033533 | 3033682 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 18 | 40374 | 40499 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 19 | 576670 | 576810 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 20 | 680340 | 680477 | + | NZ_CP039126.1 | Blautia producta |
| 21 | 318701 | 318829 | + | NZ_CP030280.1 | Blautia argi |
++ More..