Result : C0H3Y9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YjzE |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1256109 |
| Right | 1256363 |
| Strand | + |
| Nucleotide Sequence | ATGATATATGCAGGTCAAATTCAGAACCAGCAATACGCTCAATATGCTAATAGAACGATTGGACATAAGCAGGATTATGCCGGAACCGAAAAAATCAGCTATGTCCCGTTTCAGCGGGTATACAAAGAACTGGAAAAGCAGCAGGAGAATCAAACGGCAGCTGAAAGAAAAGTAAACGAGATGAAACGTAAGCGCTCTCTTTATAAGAGATTGCGAGAAAAAGGAATGGGGACATATATTAATCGATATGTATAA |
| Sequence | MIYAGQIQNQQYAQYANRTIGHKQDYAGTEKISYVPFQRVYKELEKQQENQTAAERKVNEMKRKRSLYKRLREKGMGTYINRYV |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3Y9 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1256109 | 1256363 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1419595 | 1419849 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 1225240 | 1225494 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1234480 | 1234734 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 733448 | 733702 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 1259897 | 1260151 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 1182550 | 1182804 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 2789286 | 2789540 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1155875 | 1156129 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09680.12 | 1.0 | 9 | 2861 | same-strand | Family of unknown function |
| 2 | PF14069.8 | 1.0 | 9 | 2470 | same-strand | Stage VI sporulation protein F |
| 3 | PF00580.23 | 1.0 | 9 | 119 | opposite-strand | UvrD/REP helicase N-terminal domain |
| 4 | PF13361.8 | 0.67 | 6 | 119.5 | opposite-strand | UvrD-like helicase C-terminal domain |
| 5 | PF13245.8 | 1.0 | 9 | 119 | opposite-strand | AAA domain |
| 6 | PF13673.9 | 0.89 | 8 | 74.0 | opposite-strand | Acetyltransferase (GNAT) domain |
| 7 | PF00583.27 | 0.89 | 8 | 74.0 | opposite-strand | Acetyltransferase (GNAT) family |
| 8 | PF13508.9 | 0.89 | 8 | 74.0 | opposite-strand | Acetyltransferase (GNAT) domain |
| 9 | PF08445.12 | 0.89 | 8 | 74.0 | opposite-strand | FR47-like protein |
| 10 | PF13563.8 | 0.78 | 7 | 501 | opposite-strand | 2'-5' RNA ligase superfamily |
| 11 | PF02834.18 | 0.78 | 7 | 501 | opposite-strand | LigT like Phosphoesterase |
| 12 | PF00756.22 | 0.78 | 7 | 1053 | opposite-strand | Putative esterase |
| 13 | PF01053.22 | 0.78 | 7 | 2720 | same-strand | Cys/Met metabolism PLP-dependent enzyme |
++ More..