Result : C0H3Y7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YjzK |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1252815 |
| Right | 1253021 |
| Strand | + |
| Nucleotide Sequence | GTGAATGAGTTTGAAAAATGGATAGAAGGAAGATATGAACCACATGAACAAAAGCAAAAAGAGCATGAAGACACGATGGGCAGTATCAGAAAAGACTTGGATGCATTTGATAAAGCCGGTCTGGAATTTGAAGATGAGATTGAAGAGCTGGCTGAAAAAACGGAGGCCTTACTTAAAAAACATCAAGCTCAATATGATCAATCGTAA |
| Sequence | MNEFEKWIEGRYEPHEQKQKEHEDTMGSIRKDLDAFDKAGLEFEDEIEELAEKTEALLKKHQAQYDQS |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3Y7 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1252815 | 1253021 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1231176 | 1231382 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1179253 | 1179459 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 1221936 | 1222142 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 1256586 | 1256792 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 736808 | 737014 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1416282 | 1416488 | + | NZ_CP033052.1 | Bacillus vallismortis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10612.11 | 0.86 | 6 | 2304.0 | opposite-strand | Spore coat protein Z |
| 2 | PF07552.13 | 1.0 | 7 | 1219.0 | opposite-strand | Spore Coat Protein X and V domain |
| 3 | PF07098.13 | 1.0 | 7 | 282 | same-strand | Protein of unknown function (DUF1360) |
| 4 | PF09680.12 | 1.0 | 7 | 82 | same-strand | Family of unknown function |
| 5 | PF14069.8 | 1.0 | 7 | 373 | same-strand | Stage VI sporulation protein F |
| 6 | PF00580.23 | 1.0 | 7 | 703 | opposite-strand | UvrD/REP helicase N-terminal domain |
| 7 | PF13245.8 | 1.0 | 7 | 703 | opposite-strand | AAA domain |
| 8 | PF13673.9 | 0.71 | 5 | 3426 | opposite-strand | Acetyltransferase (GNAT) domain |
| 9 | PF00583.27 | 0.71 | 5 | 3426 | opposite-strand | Acetyltransferase (GNAT) family |
| 10 | PF13508.9 | 0.71 | 5 | 3426 | opposite-strand | Acetyltransferase (GNAT) domain |
| 11 | PF08445.12 | 0.71 | 5 | 3426 | opposite-strand | FR47-like protein |
++ More..