Result : EXP03941
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03941 |
| NCBI Accession ID | |
| Organism | Lactobacillus |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGAGATTAGGTCAAAAAATTGCAGACCTACGCAAGAAAGATCATCTTTTCCAAGAGGCCTTAGCCGAAAAAATGAATGTCAGTCGGCAAGCCGTATCAATATGGGGAAGCGATCAATCGATTCCCGATATTGAAAAAATCGTGGATTTATAG |
| Sequence | MRLGQKIADLRKKDHLFQEALAEKMNVSRQAVSIWGSDQSIPDIEKIVDL |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
| Pubmed ID | 32601270 |
| Domain | CDD:419869 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1617663 | 1617815 | + | NZ_CP015444.1 | Lactobacillus helveticus |
| 2 | 344887 | 345066 | + | NZ_CP016786.1 | Clostridium isatidis |
| 3 | 468054 | 468212 | + | NZ_LR590481.1 | Hathewaya histolytica |
++ More..