Protein name |
EXP03941 |
NCBI Accession ID |
|
Organism |
Lactobacillus |
Left |
|
Right |
|
Strand |
|
Nucleotide Sequence |
ATGAGATTAGGTCAAAAAATTGCAGACCTACGCAAGAAAGATCATCTTTTCCAAGAGGCCTTAGCCGAAAAAATGAATGTCAGTCGGCAAGCCGTATCAATATGGGGAAGCGATCAATCGATTCCCGATATTGAAAAAATCGTGGATTTATAG |
Sequence |
MRLGQKIADLRKKDHLFQEALAEKMNVSRQAVSIWGSDQSIPDIEKIVDL |
Source of smORF |
Metagenomic Ribo-seq |
Function |
The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
Pubmed ID |
32601270
|
Domain |
CDD:419869 |
Functional Category |
Conserved domain based functional assignment |
Uniprot ID |
|
ORF Length (Amino Acid) |
50 |