Result : C0H3Y6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YizD |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1233133 |
| Right | 1233300 |
| Strand | - |
| Nucleotide Sequence | ATGATGTCTACTTTGATCTCAATTGTGTGCATTGCTGTTTTTTTCTGCTTGAATATCTTAGGCATGATGCATATGCTGCCGCTTTATATTACCTCTCCTCTGCTGTTTCTGTCTATTTTGTTTACCCTCTACCGCTTGAATCACCGGAAAACCTTTAAAGGGTTTTAA |
| Sequence | MMSTLISIVCIAVFFCLNILGMMHMLPLYITSPLLFLSILFTLYRLNHRKTFKGF |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3Y6 |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1233133 | 1233300 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1159565 | 1159732 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 1202261 | 1202428 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1211277 | 1211444 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 1396623 | 1396790 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 756522 | 756689 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1236905 | 1237072 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 491426 | 491599 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 9 | 1133338 | 1133511 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 10 | 1133050 | 1133217 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 11 | 2812195 | 2812362 | + | NZ_CP011937.1 | Bacillus velezensis |
| 12 | 364754 | 364927 | + | NZ_CP043404.1 | Bacillus safensis |
| 13 | 1262137 | 1262304 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 14 | 1308780 | 1308947 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 15 | 1360325 | 1360492 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 16 | 1396396 | 1396575 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 17 | 2985418 | 2985603 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 18 | 1112723 | 1112857 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 19 | 3058793 | 3058927 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 20 | 3482762 | 3482917 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 21 | 985496 | 985651 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 22 | 1502227 | 1502361 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048852.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03960.17 | 0.64 | 14 | 5040.5 | opposite-strand | ArsC family |
| 2 | PF03741.18 | 0.73 | 16 | 4341.5 | same-strand | Integral membrane protein TerC family |
| 3 | PF05389.14 | 0.91 | 20 | 3408.5 | opposite-strand | Negative regulator of genetic competence (MecA) |
| 4 | PF06054.13 | 0.73 | 16 | 2097.0 | opposite-strand | Competence protein CoiA-like family |
| 5 | PF01432.22 | 1.0 | 22 | 39.0 | opposite-strand | Peptidase family M3 |
| 6 | PF08439.12 | 1.0 | 22 | 39.0 | opposite-strand | Oligopeptidase F |
| 7 | PF13743.8 | 1.0 | 22 | 314.0 | same-strand | Thioredoxin |
| 8 | PF01323.22 | 1.0 | 22 | 314.0 | same-strand | DSBA-like thioredoxin domain |
| 9 | PF01152.23 | 1.0 | 22 | 1210.0 | same-strand | Bacterial-like globin |
| 10 | PF01464.22 | 0.86 | 19 | 1865 | same-strand | Transglycosylase SLT domain |
| 11 | PF01928.23 | 1.0 | 22 | 2612.0 | same-strand | CYTH domain |
| 12 | PF19785.1 | 0.82 | 18 | 3311.5 | opposite-strand | Family of unknown function (UPF0738) |
++ More..