Result : C0H3Y5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YizC |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1190036 |
| Right | 1190233 |
| Strand | - |
| Nucleotide Sequence | ATGAGAAATGAACTGTTTCAGCAGGCAAAATCATTTGTTCAACAGGCGGTCATGGTGACAAACGGCTTTGAGGAAGGCGATCAGGAGCAAGCGATTCTGAGAGCCAAAAATGCTGTATCTTCTGCGTATGCCAATTCGACAGATGCGGAACGTCAACAGTTGCATCAATTTCAAAATCAGCTGGACAAACTGCAATAA |
| Sequence | MRNELFQQAKSFVQQAVMVTNGFEEGDQEQAILRAKNAVSSAYANSTDAERQQLHQFQNQLDKLQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam12758. Profile Description: Protein of unknown function (DUF3813). This is an uncharacterized family of Bacillus proteins. |
| Pubmed ID | 9384377 |
| Domain | CDD:372295 |
| Functional Category | Others |
| Uniprot ID | C0H3Y5 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 23
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1190036 | 1190233 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1116367 | 1116564 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 1193786 | 1193983 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 4 | 1159170 | 1159367 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 799613 | 799810 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 1168178 | 1168375 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 7 | 1353541 | 1353738 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 2855623 | 2855820 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1089603 | 1089800 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 1271047 | 1271244 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 409959 | 410150 | + | NZ_CP043404.1 | Bacillus safensis |
| 12 | 1087529 | 1087720 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 13 | 539383 | 539574 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 1308498 | 1308686 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 15 | 3155501 | 3155695 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 16 | 264131 | 264328 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 17 | 1213883 | 1214071 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 18 | 3040970 | 3041200 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 19 | 3120958 | 3121158 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 20 | 1345006 | 1345197 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 21 | 3449925 | 3450125 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 22 | 2511701 | 2511901 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 23 | 1524686 | 1524886 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02645.18 | 0.96 | 22 | 1485.5 | same-strand | Uncharacterised protein, DegV family COG1307 |
| 2 | PF02588.17 | 0.78 | 18 | 512.0 | opposite-strand | Uncharacterised 5xTM membrane BCR, YitT family COG1284 |
| 3 | PF10035.11 | 0.78 | 18 | 512.0 | opposite-strand | Uncharacterized protein conserved in bacteria (DUF2179) |
| 4 | PF12690.9 | 0.7 | 16 | 37.5 | opposite-strand | Intracellular proteinase inhibitor |
| 5 | PF08282.14 | 1.0 | 23 | 256 | same-strand | haloacid dehalogenase-like hydrolase |
| 6 | PF01883.21 | 0.78 | 18 | 2020.0 | opposite-strand | Iron-sulfur cluster assembly protein |
++ More..