ProsmORF-pred
Result : EXP03920
Protein Information
Information Type Description
Protein name EXP03920
NCBI Accession ID
Organism Roseburia
Left
Right
Strand
Nucleotide Sequence ATGAAAAAACTTAATGATGTAGCATTGAAATTACTTGCAAAAGCAGCATATGCAAACGCAGAGAAAGAGGCAAATTCAGCGTGCCTGTTTATTGGCTATCAGCCTAAAATGCCACAGAAAGTAAAAGAACTGAAAGAAAGAAAATAG
Sequence MKKLNDVALKLLAKAAYANAEKEANSACLFIGYQPKMPQKVKELKERK
Source of smORF Metagenomic Ribo-seq
Function The ORF matches to the profile of cl27940. Profile Description: Staphylococcal AgrD protein. Members of this family of short peptides are precursors to thiolactone (unless Cys is replaced by Ser) cyclic autoinducer peptides, used in quorum-sensing systems in Gram-positive bacteria. The best characterized is the AgrD precursor, processed by the AgrB protein. Nearby proteins regularly encountered include a histidine kinase and a response regulator. This model is related to pfam05931 but is newer and currently broader in scope.
Pubmed ID 32601270
Domain CDD:391800
Functional Category Conserved domain based functional assignment
Uniprot ID
ORF Length (Amino Acid) 48
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 3
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2721600 2721746 - NZ_LR027880.1 Roseburia intestinalis L1-82
2 3463072 3463218 - NZ_LR699011.1 Roseburia hominis
3 155430 155576 + NZ_AP023367.1 Anaerocolumna cellulosilytica
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_LR027880.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF04647.17 0.67 2 10.0 same-strand Accessory gene regulator B
++ More..