Protein Information |
Information Type | Description |
---|---|
Protein name | EXP03920 |
NCBI Accession ID | |
Organism | Roseburia |
Left | |
Right | |
Strand | |
Nucleotide Sequence | ATGAAAAAACTTAATGATGTAGCATTGAAATTACTTGCAAAAGCAGCATATGCAAACGCAGAGAAAGAGGCAAATTCAGCGTGCCTGTTTATTGGCTATCAGCCTAAAATGCCACAGAAAGTAAAAGAACTGAAAGAAAGAAAATAG |
Sequence | MKKLNDVALKLLAKAAYANAEKEANSACLFIGYQPKMPQKVKELKERK |
Source of smORF | Metagenomic Ribo-seq |
Function | The ORF matches to the profile of cl27940. Profile Description: Staphylococcal AgrD protein. Members of this family of short peptides are precursors to thiolactone (unless Cys is replaced by Ser) cyclic autoinducer peptides, used in quorum-sensing systems in Gram-positive bacteria. The best characterized is the AgrD precursor, processed by the AgrB protein. Nearby proteins regularly encountered include a histidine kinase and a response regulator. This model is related to pfam05931 but is newer and currently broader in scope. |
Pubmed ID | 32601270 |
Domain | CDD:391800 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 48 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2721600 | 2721746 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
2 | 3463072 | 3463218 | - | NZ_LR699011.1 | Roseburia hominis |
3 | 155430 | 155576 | + | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04647.17 | 0.67 | 2 | 10.0 | same-strand | Accessory gene regulator B |