Result : EXP03916
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03916 |
| NCBI Accession ID | |
| Organism | Roseburia |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | GTGTATAATAAAGCTGTTATAAAAAAAACAGATCATCACAAAAGTGATGTCGAAAACAAAAAATGGGGTGCTCGCACAGGCGGGCTGAGAGTAAGCGGACGCTTTAACCCGGAACCTGATTTGGATAATGCCAACGTAGGGAGATAA |
| Sequence | MYNKAVIKKTDHHKSDVENKKWGARTGGLRVSGRFNPEPDLDNANVGR |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1699352 | 1699498 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 2 | 2920262 | 2920402 | - | NZ_LR699011.1 | Roseburia hominis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR027880.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08543.14 | 1.0 | 2 | 172.0 | same-strand | Phosphomethylpyrimidine kinase |
| 2 | PF02133.17 | 1.0 | 2 | 969.0 | same-strand | Permease for cytosine/purines, uracil, thiamine, allantoin |
| 3 | PF09512.12 | 1.0 | 2 | 2196.5 | same-strand | Thiamine-precursor transporter protein (ThiW) |
| 4 | PF12822.9 | 1.0 | 2 | 2196.5 | same-strand | ECF transporter, substrate-specific component |
| 5 | PF07155.14 | 1.0 | 2 | 2196.5 | same-strand | ECF-type riboflavin transporter, S component |
++ More..