Result : EXP03915
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03915 |
| NCBI Accession ID | |
| Organism | Bacteroides,Parabacteroides,Paraprevotella,Odoribacter,Alistipes,Prevotella,Alloprevotella |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGAACACACGGAGAATCCACCATATTGGTTTTGGCATCAAGGCATTGTCAATAATAATAATATAGACTCCAGTGTAAATATGGAAGCTGTAAGCCGGACATTGTCAAGATTGGTGCTCATTAAAGACAACAAATCAAGTAATTAA |
| Sequence | MEHTENPPYWFWHQGIVNNNNIDSSVNMEAVSRTLSRLVLIKDNKSSN |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2590708 | 2590851 | - | NZ_CP032819.1 | Butyricimonas faecalis |
| 2 | 2008701 | 2008844 | - | NZ_LT906459.1 | Odoribacter splanchnicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP032819.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13149.8 | 1.0 | 2 | 2615.5 | same-strand | Fimbrillin-like |
++ More..