Result : C0H3Y3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YhzF |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1074381 |
| Right | 1074572 |
| Strand | + |
| Nucleotide Sequence | TTGTCTGTCTTTTTGATTGTATTATCCTGCATCACCCTTGCCTTCGCTTCAGGCGCTGTTTACTATATCAAACTTCTCAGCCAGGCTGCTTCTTATCCGCCCAAGAGGGTTATCCGGCAGAAAGCGCTTGTTTGTTCAACCGGAACCGCCTTTACACTATGTCTTATCTTTTTCACAAAACTCCTCGCTTAA |
| Sequence | MSVFLIVLSCITLAFASGAVYYIKLLSQAASYPPKRVIRQKALVCSTGTAFTLCLIFFTKLLA |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | C0H3Y3 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1074381 | 1074572 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1047041 | 1047232 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1058674 | 1058865 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 917951 | 918142 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 1006726 | 1006917 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 1254668 | 1254859 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 1078241 | 1078432 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2945709 | 2945900 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1000966 | 1001157 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 642672 | 642863 | - | NZ_CP017786.1 | Bacillus xiamenensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13616.8 | 0.9 | 9 | 3139 | opposite-strand | PPIC-type PPIASE domain |
| 2 | PF00639.23 | 0.9 | 9 | 3139 | opposite-strand | PPIC-type PPIASE domain |
| 3 | PF13145.8 | 0.9 | 9 | 3139 | opposite-strand | PPIC-type PPIASE domain |
| 4 | PF11667.10 | 1.0 | 10 | 1820.0 | opposite-strand | Putative zincin peptidase |
| 5 | PF08963.12 | 1.0 | 10 | 1270.5 | same-strand | Protein of unknown function (DUF1878) |
| 6 | PF01047.24 | 1.0 | 10 | 663.5 | opposite-strand | MarR family |
| 7 | PF13463.8 | 1.0 | 10 | 663.5 | opposite-strand | Winged helix DNA-binding domain |
| 8 | PF12732.9 | 1.0 | 10 | 118.0 | opposite-strand | YtxH-like protein |
| 9 | PF06013.14 | 0.9 | 9 | 118 | opposite-strand | Proteins of 100 residues with WXG |
| 10 | PF17099.7 | 1.0 | 10 | 74.0 | opposite-strand | Tryptophan transporter TrpP |
| 11 | PF00266.21 | 1.0 | 10 | 716.0 | opposite-strand | Aminotransferase class-V |
| 12 | PF01230.25 | 1.0 | 10 | 1940.5 | opposite-strand | HIT domain |
| 13 | PF11969.10 | 1.0 | 10 | 1940.5 | opposite-strand | Scavenger mRNA decapping enzyme C-term binding |
| 14 | PF00005.29 | 1.0 | 10 | 2865.0 | same-strand | ABC transporter |
| 15 | PF05975.14 | 1.0 | 10 | 3601.0 | same-strand | Bacterial ABC transporter protein EcsB |
++ More..