| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03905 |
| NCBI Accession ID | |
| Organism | Faecalibacterium |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGAAACCGAACACAGCAAGAAATTTAATGACATCAAGTTCTACTACGAGCACCATATCTGGCGCAAAACCACTGTAAAAAAAGCCTGCAAAACTGGCCGCATCACCGCCGCCGAGTATGAGGAGATCACCGGCGAGAAGTATGTGGCCTGA |
| Sequence | METEHSKKFNDIKFYYEHHIWRKTTVKKACKTGRITAAEYEEITGEKYVA |
| Source of smORF | Metagenomic Ribo-seq |
| Function | The ORF matches to the profile of cl23995. Profile Description: Phage uncharacterized protein (Phage_XkdX). This model represents a family of small (about 50 amino acid) phage proteins, found in at least 12 different phage and prophage regions of Gram-positive bacteria. In a number of these phage, the gene for this protein is found near the holin and endolysin genes. [Mobile and extrachromosomal element functions, Prophage functions] |
| Pubmed ID | 32601270 |
| Domain | CDD:420140 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 847390 | 847530 | + | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 2 | 765517 | 765654 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 3 | 626492 | 626626 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10076.11 | 0.67 | 2 | 2222.0 | same-strand | Uncharacterised protein conserved in bacteria (DUF2313) |