Result : C0H3Y1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YhzD |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 1062279 |
| Right | 1062464 |
| Strand | - |
| Nucleotide Sequence | ATGGCTGATTATTTCCTTACCGTATTTGATCCTTCGGGGAACACGCTGGTAAACGAGCAATTCGAGGCAGAACATGAAGAAGCGGCAAAAACGCATGGTGAAGCCCTCTTAAAAGAAAAAGAGCTTCATAGTCATACTCATCGTTTAGTCAATGCAGCCGGAAAGCTGATTTTGTTTCACAGATGA |
| Sequence | MADYFLTVFDPSGNTLVNEQFEAEHEEAAKTHGEALLKEKELHSHTHRLVNAAGKLILFHR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam14120. Profile Description: YhzD-like protein. The YhzD-like protein family includes the B. subtilis YhzD protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length. There is a conserved GKL sequence motif. |
| Pubmed ID | 9384377 |
| Domain | CDD:379480 |
| Functional Category | Others |
| Uniprot ID | C0H3Y1 |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 43
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1062279 | 1062464 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1046567 | 1046752 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1034955 | 1035140 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 1242573 | 1242758 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 930084 | 930269 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 1066103 | 1066288 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 994621 | 994806 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 3185779 | 3185964 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 9 | 1067307 | 1067492 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 10 | 1157856 | 1158041 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 11 | 551602 | 551787 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 12 | 3221678 | 3221863 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 13 | 989843 | 990028 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 14 | 1014857 | 1015042 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 15 | 4093391 | 4093576 | + | NZ_CP040336.1 | Bacillus luti |
| 16 | 1414312 | 1414497 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 17 | 2957759 | 2957944 | + | NZ_CP011937.1 | Bacillus velezensis |
| 18 | 652516 | 652686 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 19 | 897248 | 897433 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 20 | 3332210 | 3332395 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 21 | 665575 | 665760 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 22 | 975925 | 976095 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 23 | 2633918 | 2634103 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 24 | 988925 | 989110 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 25 | 2934948 | 2935133 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 26 | 518638 | 518826 | + | NZ_CP043404.1 | Bacillus safensis |
| 27 | 699549 | 699734 | + | NZ_CP013661.2 | Planococcus kocurii |
| 28 | 1069258 | 1069443 | - | NZ_CP019401.1 | Planococcus faecalis |
| 29 | 3339597 | 3339782 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 30 | 1406076 | 1406264 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 31 | 3762973 | 3763161 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 32 | 1355106 | 1355291 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 33 | 998256 | 998441 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 34 | 1261388 | 1261549 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 35 | 103032 | 103217 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 36 | 836280 | 836465 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 37 | 1009783 | 1009953 | - | NZ_CP016540.2 | Planococcus versutus |
| 38 | 1619765 | 1619950 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 39 | 1030168 | 1030353 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 40 | 2885135 | 2885320 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 41 | 1607668 | 1607853 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 42 | 803001 | 803186 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 43 | 1136012 | 1136197 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00378.22 | 0.67 | 29 | 40 | opposite-strand | Enoyl-CoA hydratase/isomerase |
| 2 | PF00005.29 | 0.81 | 35 | 150 | opposite-strand | ABC transporter |
| 3 | PF13732.8 | 0.72 | 31 | 142.0 | opposite-strand | Domain of unknown function (DUF4162) |
| 4 | PF12698.9 | 0.72 | 31 | 1033 | opposite-strand | ABC-2 family transporter protein |
| 5 | PF00149.30 | 0.72 | 31 | 2384 | opposite-strand | Calcineurin-like phosphoesterase |
| 6 | PF12850.9 | 0.74 | 32 | 2384.5 | opposite-strand | Calcineurin-like phosphoesterase superfamily domain |
| 7 | PF13514.8 | 0.7 | 30 | 3609.0 | opposite-strand | AAA domain |
| 8 | PF01966.24 | 0.79 | 34 | 5439.0 | opposite-strand | HD domain |
| 9 | PF01336.27 | 0.72 | 31 | 4432 | opposite-strand | OB-fold nucleic acid binding domain |
++ More..