Protein Information |
Information Type | Description |
---|---|
Protein name | EXP03899 |
NCBI Accession ID | |
Organism | Actinomyces,Lautropia |
Left | |
Right | |
Strand | |
Nucleotide Sequence | GTGAGCAACTACTACGAGGTCCTCGGCGTCAGCCGCGACGCCAGCCCCGAGGAGATCAAGAAGGCCTACCGCAAGAAGGCCCGCCAGCTTCACCCCGACGTCGCCGGCCCCGGCCACGAGGAGGAGTTCAAGGAGGTCTCCTCCGCCTACTAG |
Sequence | MSNYYEVLGVSRDASPEEIKKAYRKKARQLHPDVAGPGHEEEFKEVSSAY |
Source of smORF | Metagenomic Ribo-seq |
Function | The ORF matches to the profile of cl02542. Profile Description: N/A. DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. |
Pubmed ID | 32601270 |
Domain | CDD:413365 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 50 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1424360 | 1424533 | - | NC_014033.1 | Prevotella ruminicola 23 |
2 | 2530172 | 2530342 | - | NZ_CP011947.1 | Haloferax gibbonsii |
3 | 1983873 | 1984019 | - | NZ_LN831302.1 | Halobacterium hubeiense |
4 | 2694393 | 2694563 | + | NZ_CP039139.1 | Haloferax mediterranei ATCC 33500 |
5 | 2845368 | 2845538 | + | NZ_CP081958.1 | Halobaculum magnesiiphilum |
6 | 2849208 | 2849378 | + | NZ_CP082286.1 | Halobaculum roseum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01910.19 | 0.67 | 4 | 4467.0 | both-strands | Thiamine-binding protein |
2 | PF02289.18 | 0.67 | 4 | 2706.5 | opposite-strand | Cyclohydrolase (MCH) |
3 | PF00009.29 | 0.83 | 5 | 94 | same-strand | Elongation factor Tu GTP binding domain |
4 | PF03144.27 | 0.83 | 5 | 94 | same-strand | Elongation factor Tu domain 2 |
5 | PF03143.19 | 0.83 | 5 | 94 | same-strand | Elongation factor Tu C-terminal domain |
6 | PF00215.26 | 0.83 | 5 | 603 | same-strand | Orotidine 5'-phosphate decarboxylase / HUMPS family |