Result : EXP03890
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP03890 |
| NCBI Accession ID | |
| Organism | Ruminococcus,Eubacterium,Blautia |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | ATGGCTGAGATAAATATAGCAAAGCAGCTTTTGGCTGCTCGTCATGAAAAGAAAATTACACAGGAGGAGCTTGCCAGCTATGTTGGTGTTTCCAAGGCGGCGGTGTCGAAGTGGGAAAGTGGTGTTTCCCAAACAAAAAGATATTAA |
| Sequence | MAEINIAKQLLAARHEKKITQEELASYVGVSKAAVSKWESGVSQTKRY |
| Source of smORF | Metagenomic Ribo-seq |
| Function | |
| Pubmed ID | 32601270 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 48 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3696841 | 3696987 | - | NZ_CP019870.1 | Clostridioides difficile |
| 2 | 1904226 | 1904372 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 3 | 2629160 | 2629315 | + | NZ_CP030280.1 | Blautia argi |
| 4 | 1110936 | 1111073 | + | NZ_CP039126.1 | Blautia producta |
| 5 | 2409965 | 2410111 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019870.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02486.21 | 0.6 | 3 | 2724 | same-strand | Replication initiation factor |
| 2 | PF18106.3 | 0.6 | 3 | 2724 | same-strand | Rolling Circle replication initiation protein N-terminal domain |
++ More..